KEGG   Methanothrix soehngenii: MCON_2721Help
Entry
MCON_2721         CDS       T01468                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mcj  Methanothrix soehngenii
Brite
Enzymes [BR:mcj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MCON_2721 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 GCD14 Ubie_methyltran Methyltransf_11 Fibrillarin CMAS Methyltransf_3 RrnaAD MTS Methyltr_RsmB-F Methyltransf_2 DUF938 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: AEB69120
UniProt: F4BZX5
Position
2318399..2319034
Genome map
AA seq 211 aa AA seqDB search
MEPGKRLLDGMRGRINESVLKAMARVPRDRFVPAQLRDRAYEDLPLPIGFGQTISAPHMV
AIMCDLLDVRPGMKILEVGGGSGYHAAVLAALAGPEGQVFSVERMPDLALAARKNLQAAG
IAGVTVVEGDGSLGLPEHAPYDRISVAASAPRVPEPLKEQLRVGGKLILPVGETSQELVL
VTRKNGFAVEEKMGVIFVPLIGKEGFGERQI
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaggcaaaaggcttcttgacggcatgcgaggcaggataaatgaatcagtcctg
aaagccatggcccgcgttcccagagatagattcgttcccgcgcagcttcgagatagggct
tatgaggacctccccctgcccataggatttggccagaccatctccgccccacatatggtg
gctataatgtgcgaccttcttgatgtcaggccgggaatgaagatcctggaggtgggcggt
ggaagcggctaccatgcggccgtgctggcagctcttgcaggtcccgagggccaggtcttc
tctgtggagaggatgcctgatctcgctcttgccgccagaaaaaatctgcaggcggcagga
attgcaggtgtcaccgtggttgagggcgacggcagcctgggccttccagagcatgctccc
tacgatagaatcagcgttgcagcatcagctcccagagttcccgaacccctaaaagagcag
ctccgggtgggaggcaagctgatacttccggttggagagacatcacaggagctggtctta
gtcaccaggaagaacggctttgccgtggaggaaaagatgggagtgatcttcgtccccctc
atcggcaaagaggggtttggagaacggcagatttga

DBGET integrated database retrieval system