KEGG   Methanosaeta concilii: MCON_2723Help
Entry
MCON_2723         CDS       T01468                                 

Definition
peptidase, ArgE/DapE family
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mcj  Methanosaeta concilii
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCON_2723
  Amino acid metabolism
   00300 Lysine biosynthesis
    MCON_2723
Enzymes [BR:mcj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MCON_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2320637..2321884
Genome map
AA seq 415 aa AA seqDB search
MREDSKPEETILPDRDYLMDLLKNIISFRTVAPPGDCYQEIVEWLEPIFRDMGFETTKMK
MPAEVFAAKCSDSRLVGDRYNLQADLSVGAEKTLVIYAHLDVVPAEGEWDTDPFCAVQKN
GRVYGRGVSDCKGSVAALVAALKALLSKKKPKYNLSILLTTDEEVGGYSGLCYLTDLGQV
KGDLMLCMDGFSDDVGIGSNGIITWDVMVKGRSAHSGSSFLGVNAVERSILVMERLIDLK
KVVQARRSRLPASSPVKSVGIENLMPILNITMINGGVKENIVPDRCVLRGDRRVIPEERM
EEAMEEIERALEPLRSEGIDFELKFYPGYPPMSVDPEHAWVNEVREAVERRMGFMPQLSA
AQGSLDQAYATEKTGIPTCVYGVGRQLESNIHAPNENVRIADLEGYTKFLIELLQ
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaagattcaaagcccgaagagaccattcttccagatcgagattatcttatggat
ctgctcaagaatatcataagtttcaggacggtcgcccctccaggagactgctatcaggag
atagtggagtggctggagcccatattcagggatatgggatttgagacgaccaaaatgaag
atgcccgcggaggtatttgccgccaaatgcagtgatagccggctggtaggagaccggtac
aacctccaggccgatttatcggttggagcggaaaagaccctggtgatatatgcccacctg
gatgtggtgccggcagagggcgaatgggacaccgatccattctgtgcggtgcagaagaac
ggccgggtctatggccggggggtctcagactgcaagggatcggtcgcggccctcgtcgct
gctctgaaggcgcttttgtccaagaaaaagcccaagtacaatctgagcattctcttgacc
accgatgaggaggttggaggctactccggcctgtgctatctgactgatctgggccaggtg
aaaggggatctgatgctctgcatggatggcttttccgatgacgtggggatcgggagcaat
ggcatcataacctgggatgtaatggttaaaggtcggtcggcccacagcggatcgagcttc
ctgggggtcaatgcggtagaaaggtcgattttggtcatggagaggcttatagacctgaag
aaggtggtacaagccagacggtcccgccttcccgccagctcgccggtgaaatcggtggga
atagagaacctcatgccaatcctcaatatcaccatgatcaatggaggggtcaaagagaac
atagtgcccgataggtgcgttctccggggggatcgcagggtgataccggaggagaggatg
gaagaggcgatggaggagatcgagagggcgctggagccattgaggtcagagggtatcgac
tttgagctgaagttctatcccggatatccgcccatgagcgttgacccggagcatgcctgg
gtgaatgaggtgagggaagcagtggagaggaggatgggatttatgccccagctctcagca
gcccagggaagcttagaccaggcctatgccacagagaagacggggattcccacctgcgtc
tacggcgtgggccggcagctggagagcaatatccatgctccaaatgagaacgtgcgcata
gctgatctggaagggtataccaaattcttaattgagctattgcagtag

DBGET integrated database retrieval system