KEGG   Methanosaeta concilii: MCON_2868Help
Entry
MCON_2868         CDS       T01468                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mcj01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcj00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mcj00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mcj00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mcj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2438683..2440668
Genome map
AA seq 661 aa AA seqDB search
MKSDTAKTAVLQEETRIFNTPQWIIEHSNSYQWMKNKGFKTENEMRKWCSDNYIEFWDEM
ARTFVDWFKPYTQILDDSEKPHYKWFTGGKVNVAYNAVDRHAHSEKRNKVAYYFVGEPVG
DAKAITYYQLYREVNRLANALKSVGVEKGDRVVTYLPMIPEQPITMLACAKIGAIHTLVF
SGFSSGGLASRVNDAEAKVVVTADGFYRRGKPLPLKPNVDEALKNSPSVKKVIVVKRTGV
SVPMTEGRDVYYDDFVAGQSTKCETVPLDPEDRLFILYTSGTTGKPKGIEHAHGGYAVGA
AQTTSWVLDVHDDDVYWCTADAGWITGHSYVIYGPLILGASSILYEGSPDFPDLGRWWSI
IEEYGVSVFYSAPTAVRMFMKSGEEFVKKYDLSSIRILASVGEPLNPEAYMWFRKNIGSD
QAPIMDTWWQTETGCHVVAPLAMTPEKPGSVCFPLPGMNTDIYDEDANSVPLGYGGNIVQ
TAPWPSMLRAFFRDEIRYKKEYWDMYWQVKPGTYLAGDKATRDKDGYWWIQGRIDDVLKV
AGHRISNAEVESAAVSHPKVAEAAVIGEPDEVKGEKIVAFIILKEGVVEEESLKKDISTH
VRKVLGPVAYPDKVYFVKDVPKTRSGKIMRRVIKAKALGKDTGDVSALSNPEAVSSIPQI
N
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggatacggcaaaaacggctgttctccaggaagagacaaggattttcaatact
ccgcaatggattattgagcactcgaattcgtatcagtggatgaagaataagggcttcaag
actgagaatgaaatgcgcaagtggtgctcggacaattacatagaattctgggatgagatg
gccaggaccttcgtcgattggttcaagccctacacccagattctcgacgattccgaaaag
ccccattacaagtggtttactggcggcaaggtcaatgtggcctacaatgcagttgacagg
catgcccactccgagaaacgcaacaaagtagcttactacttcgtcggcgagcccgtgggc
gatgcaaaagctatcacctactatcagctctatagagaagtcaacaggctggccaacgcc
ctcaagagcgtgggagtagagaagggagaccgagttgttacgtaccttcctatgattcca
gagcagcccatcaccatgctggcatgcgccaagatcggagctattcatacactggtgttc
tctggattctcctcaggcggcttggccagcagggtcaacgatgccgaggccaaggtcgtc
gtcactgccgacggcttctacaggcgcggaaaacccctgcccctcaagcctaatgtcgat
gaggccttgaagaactcaccctccgttaagaaggtgatagtagtcaagaggacaggagtc
tctgtgcccatgactgagggccgagatgtctattatgacgatttcgtagctggccagtcc
accaagtgtgaaaccgtcccgcttgatccggaggataggctgttcattctgtacacctcc
ggcacaaccggcaagcccaaaggtattgagcacgctcacggcggatatgctgttggtgca
gcccagacaacctcatgggtgctggatgtccacgatgatgacgtctactggtgcacggct
gatgcaggctggatcaccggacactcctacgtgatctacggtccgctgatcctgggtgcc
tccagcatcctgtacgaaggctctcccgacttcccggatctgggccgctggtggtccatc
attgaggagtatggcgtctctgtattctacagcgcacccaccgctgtaaggatgtttatg
aaatccggtgaggaattcgtcaagaagtacgacctgtccagcatcagaattctggcatcg
gtaggcgagccgcttaatccagaggcctacatgtggttcagaaagaacataggctccgac
caggcacctatcatggatacctggtggcagaccgagacaggatgccatgtcgttgcaccg
ctggccatgacacctgagaagccgggttctgtctgctttccgctgcccggcatgaacacc
gatatctacgacgaggatgccaactcggtcccactgggctacgggggcaatatcgtccaa
acggccccctggccgtccatgctccgcgccttcttcagagatgagatcaggtacaagaag
gagtactgggatatgtactggcaggtcaagcccggcacatacctggcaggagacaaggcc
acccgtgacaaagacggatactggtggatccagggcagaatagatgatgtgcttaaggta
gcaggacatagaatatccaacgctgaggttgagtccgctgcagtatctcatcccaaggtc
gcagaggccgctgttatcggtgagcccgatgaggtcaagggcgagaagatcgttgcattc
attattctcaaggaaggagtggttgaggaggagtcgctcaagaaggatatctccactcac
gtaaggaaggtcctgggcccggttgcttatccagacaaggtctatttcgtcaaggatgtg
cccaagaccaggtccggcaagatcatgcgccgcgtcatcaaggccaaggcgctgggcaag
gataccggtgatgtatcagcactatccaatccggaggcggtaagcagcataccacagata
aattag

DBGET integrated database retrieval system