KEGG   Methanosaeta concilii: MCON_2873Help
Entry
MCON_2873         CDS       T01468                                 

Definition
methyltetrahydromethanopterin S-methyltransferase subunit H
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mcj  Methanosaeta concilii
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_2873
  Energy metabolism
   00680 Methane metabolism
    MCON_2873
Enzymes [BR:mcj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     MCON_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2443346..2444269
Genome map
AA seq 307 aa AA seqDB search
MFRFKNEQTIVNVAGVRFGGQPGELPTVLCGTIFYQGHRIVEDDERGIFDRAAAERLVLR
QSELSSETGCPFVLHIYARTVSALQKYLDFAEEVWSGPFIVDSAERSTRSLALSLLSELG
YADKAIYNSISIATDDAEARALLENEVDSAIILAYNPGEPGVEGAMRILENGGLVRDEGL
IPLSKRLGISNILIDPGVVPMGSGAGSSLRFSVVAKSRLGLPVGSGIHNAVSSWQWLKDR
MKSNRSCCDAAAACMQLAMGGDFLLYGPIESGEVIFPAAAMADILVAEAVRDLEVYPEAT
HPIFRLV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgttccggtttaagaatgagcagaccatagtgaatgtggccggggtaaggttcggaggc
cagcccggagagctgccaaccgtcctttgcggcaccatcttctatcaggggcacaggatt
gtggaggatgatgagcgaggaatattcgatcgggccgcagcggagaggctagttctgcgc
caatctgagctttccagtgagaccggttgcccttttgtcctacatatctatgcccggacc
gtttccgccctgcagaagtatctggattttgcggaagaggtctggtcggggccgtttatc
gtcgactcggcagagaggagcactcgctctttagccctatcgctgctctcggaattgggg
tatgcagacaaagccatatataacagcataagcattgccacagatgatgccgaggcccgg
gccttgctggagaatgaggttgacagcgccatcatcctcgcttacaatcccggtgagccg
ggagtggaaggagccatgcggatcttggagaatggtggcctggtgagagacgaggggctg
atacccctgtcaaagaggcttgggatcagcaacattctcatcgatccaggggtggtgccg
atgggcagcggagcggggtcctctctgcgcttctcggtggttgccaaatcacgcctcgga
ctgcctgttggctcgggaattcataatgcagtcagctcctggcagtggctcaaggatagg
atgaagagcaaccgaagctgctgcgatgccgcagctgcctgcatgcagcttgccatggga
ggcgactttctcctctatggacccattgagagcggcgaggtcatctttccggcagcggcc
atggccgatattctggtggcagaggcggtaagggatctggaggtctatcccgaggccacc
catcccatcttccgcctggtttag

DBGET integrated database retrieval system