KEGG   Methanosaeta concilii: MCON_2908Help
Entry
MCON_2908         CDS       T01468                                 

Definition
hypothetical protein
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_2908
   01230 Biosynthesis of amino acids
    MCON_2908
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_2908
Enzymes [BR:mcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MCON_2908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2471934..2473088)
Genome map
AA seq 384 aa AA seqDB search
MKCNAGFVGFDGTENKRTLLATAEVKKAAGIDGDLNVLLRKPHGRARSIMAKFNRLYGVK
AYLSDMALKDKWQAAGVTIEGGYDDFFSASDFIMVGTPGDQELPYLEAGLANDCFVSLMG
GADRPGLLKGLEENKKVKITEELKADFAREFFFGLENYQMFLNAKPKLVQCTSCNTTGLS
RLALAARPLGLTAVLGNIDRRHGDPHTVVKASPSAIQFGKGAGHQGTDAGTIFEEVNFSI
RASKVPTTVPHTNFLNLVFKGDVTASQLVEQYAKTREVVVMPYQDEGKKHDWTSEILEAF
LSGIERPISPEIFELIVSDAIIPFRLGDYTILQTVSMVEQMSIAVPNHVESYLLSAGYPA
DDVHSLVDKTLGIMHGIWPDKLSC
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtgtaatgcaggctttgtgggtttcgatggaacagagaataaaaggactcttctt
gctaccgcagaggtcaagaaagcggctggaatcgatggcgatctgaatgtgctcctcaga
aaacctcatggccgggccaggtctatcatggccaagttcaaccgcctttacggggtgaag
gcctatctcagcgatatggcccttaaggataagtggcaggccgcaggggtgacgatcgaa
ggcggatacgatgacttcttttctgcatccgattttatcatggtgggaacccccggagac
caggagctgccctacctggaggcgggcctggccaacgactgcttcgtctccctcatggga
ggagcagaccggcctgggctcctgaagggattggaggagaacaagaaggtcaagatcaca
gaggagctgaaagcggacttcgcccgagagttcttctttggtctggaaaactatcagatg
ttcctaaatgccaaaccgaagctggtgcagtgcacaagctgcaacaccacgggcctctcc
cggctggctctggccgcccggcccctgggccttaccgccgtcctggggaacatcgaccgc
aggcatggagatccgcatactgtggtcaaggcctcgcccagcgccattcagttcggcaag
ggagctggccaccagggaacagatgctggaaccatcttcgaggaggtcaacttctccatc
cgggcgagcaaggtgccaaccaccgtcccccacaccaacttcctgaatctggtcttcaag
ggagatgtgactgcaagtcagctggtagagcagtacgccaagacaagagaagtggtggtg
atgccctatcaggacgagggcaagaagcacgattggaccagcgagatcttagaggctttc
ctatccggcatagaaaggcccatcagcccggagatattcgaactcatagtctccgatgcc
ataatcccctttaggcttggcgactacaccatccttcagacagtctccatggtggagcag
atgtccatcgccgtgccaaaccacgttgagtcctatctgctttctgcaggctatcccgca
gacgacgtgcactctctggtggataagaccctgggcatcatgcatggcatctggccggat
aaactgagctgctga

DBGET integrated database retrieval system