KEGG   Methanosaeta concilii: MCON_3293Help
Entry
MCON_3293         CDS       T01468                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mcj01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcj01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcj00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mcj00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mcj00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2774793..2775458
Genome map
AA seq 221 aa AA seqDB search
MTIIVLNFKTYRESTGPEALRLAEICEDIARDYSVQMIVAPQTADIHAISREVKIPVYAQ
HVDGVGYGGFTGHVTAASIKAAGARGSLINHSERRIKLADMEASLSACRDLGLASIICTN
NVATTRAAAALEPDYVAVEPPELIGSGIPVSKANPNVVSDSVSAVKKIAPRVGVLCGAGI
THGEDLRSALDLGSEGVLLASGIIKAKDQRQALEDLVTGAK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccataattgtgctcaatttcaagacctaccgtgagtctacaggcccggaggctctg
cgcctggccgagatctgcgaggatatcgccagggactattctgtgcagatgatagtggca
ccccagacggcagacatccatgccatatctcgtgaggtaaaaattccggtctacgcccag
catgtggatggcgttggctatggcggctttaccggccatgtgaccgccgcttccataaaa
gcagcaggtgcgagaggttcactcataaaccactcggagagaaggatcaagctggccgat
atggaagcctccctctccgcctgccgggatcttggcctcgcgagcatcatctgcaccaac
aacgtggccaccaccagggctgcggcagctcttgaacctgattatgtggcagtggagcct
ccagagctcataggaagcggaattccggtatccaaggccaatcccaacgtggttagcgat
tctgtcagcgcggtcaagaaaatcgcccctcgtgtgggggtcctttgcggcgcggggata
acccatggcgaggatctgagaagcgctctggacctgggatcggagggcgtcttgctggca
tcgggaatcattaaagccaaggatcagcgtcaggctttagaggatcttgtgactggggca
aaatag

DBGET integrated database retrieval system