KEGG   Methanosaeta concilii: MCON_3293Help
Entry
MCON_3293         CDS       T01468                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_3293 (tpiA)
   01230 Biosynthesis of amino acids
    MCON_3293 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_3293 (tpiA)
   00051 Fructose and mannose metabolism
    MCON_3293 (tpiA)
   00562 Inositol phosphate metabolism
    MCON_3293 (tpiA)
Enzymes [BR:mcj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MCON_3293 (tpiA)
Exosome [BR:mcj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MCON_3293 (tpiA)
  Exosomal proteins of bladder cancer cells
   MCON_3293 (tpiA)
  Exosomal proteins of melanoma cells
   MCON_3293 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2774793..2775458
Genome map
AA seq 221 aa AA seqDB search
MTIIVLNFKTYRESTGPEALRLAEICEDIARDYSVQMIVAPQTADIHAISREVKIPVYAQ
HVDGVGYGGFTGHVTAASIKAAGARGSLINHSERRIKLADMEASLSACRDLGLASIICTN
NVATTRAAAALEPDYVAVEPPELIGSGIPVSKANPNVVSDSVSAVKKIAPRVGVLCGAGI
THGEDLRSALDLGSEGVLLASGIIKAKDQRQALEDLVTGAK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaccataattgtgctcaatttcaagacctaccgtgagtctacaggcccggaggctctg
cgcctggccgagatctgcgaggatatcgccagggactattctgtgcagatgatagtggca
ccccagacggcagacatccatgccatatctcgtgaggtaaaaattccggtctacgcccag
catgtggatggcgttggctatggcggctttaccggccatgtgaccgccgcttccataaaa
gcagcaggtgcgagaggttcactcataaaccactcggagagaaggatcaagctggccgat
atggaagcctccctctccgcctgccgggatcttggcctcgcgagcatcatctgcaccaac
aacgtggccaccaccagggctgcggcagctcttgaacctgattatgtggcagtggagcct
ccagagctcataggaagcggaattccggtatccaaggccaatcccaacgtggttagcgat
tctgtcagcgcggtcaagaaaatcgcccctcgtgtgggggtcctttgcggcgcggggata
acccatggcgaggatctgagaagcgctctggacctgggatcggagggcgtcttgctggca
tcgggaatcattaaagccaaggatcagcgtcaggctttagaggatcttgtgactggggca
aaatag

DBGET integrated database retrieval system