KEGG   Macrococcus caseolyticus: MCCL_0078Help
Entry
MCCL_0078         CDS       T00848                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mcl  Macrococcus caseolyticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(80693..81256)
Genome map
AA seq 187 aa AA seqDB search
MLKIKAPQTVYFQGNDHAVLLLHSFTGTTRDMKLIGDALAEADFSYMIPAYPGHGQPIET
FIQHSIMDWWKVVEEAYLQLLAQGFQKISVIGVSLGGLFTLKLVEQFNFHQAIIMSTPMH
KEAVNLEERLKHYAENTQKIFSENELSENNINNLIKNYYGTPLFIQMIDEIMTHLSDIQT
PIELKKK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaattaaagctccacaaacagtttatttccaaggaaatgatcacgcagtactc
ttactccattcattcactggtacgacaagagatatgaagttaattggtgatgcattagca
gaagcagatttttcatatatgattcctgcttatccaggacacgggcagcctattgaaaca
tttatacagcattcaataatggactggtggaaagtagttgaagaagcgtatttacaactg
ctcgcccaaggttttcaaaaaatatctgtaattggtgtctcacttggtgggctattcacc
ttaaagttagtggaacaattcaattttcatcaagcaatcattatgagtaccccgatgcat
aaagaagctgtaaatttagaagagagattgaagcattatgcagagaacacacaaaaaata
ttctctgaaaatgaactttcagagaataatatcaataatctaataaaaaactattatggc
actcctttgttcatacaaatgattgatgagattatgactcatctatctgatattcaaaca
ccgatagagctcaagaagaagtga

DBGET integrated database retrieval system