KEGG   Macrococcus caseolyticus: MCCL_0235Help
Entry
MCCL_0235         CDS       T00848                                 

Gene name
hsdR
Definition
type III restriction-modification system restriction endonuclease subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mcl  Macrococcus caseolyticus
Brite
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     MCCL_0235 (hsdR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
229877..232843
Genome map
AA seq 988 aa AA seqDB search
MSIELSILPHQNEFLKAVRKAFEDIRVMSNEDIHQNSIIDLDDNKIKENINDLWNGYQGL
QKIPMAWRTRDDDDYLGIDIRMETGTGKTYCYTRMMYELNEMYGFNKFILLVPSTSIKEG
SKSFLQADYSNRHFSDLYPNKSLELSILEPQKKTKGRKMFPAAISEFARGTSLEKNRFSV
LLMTSGMLLSNATMAKDDYDQTILGNFSQPYETLRATRPIVIIDEPHRFKKENQAYQRIL
KELHPQCIIRFGATFPDKKSSKDKDYNNLIFNLGPNQAFNQNLVKGVETFMIDAERKNET
KLKLMDFKRSPKLCTFRDEMTKKPIELSRGDNLSKFGEEFSGITIEEIGPTSDDAIKSGV
TLSNGQILAKGDVVYGGIYTETYQELMLKQSIVNHLETEKKNFLRGNKIKTLSLYFIDSV
RSYREKDDRPGHLRIKFESMLSDAFKKEIRSIGNTKDQRLQEYKSYLESSLVEISKTNGG
YFSDDDSTSDKDIQKEVDKILRNKEALLNFHDETGRWNTMRFIFSKWTLKEGWDNPNVFQ
IVKLRSSGSEISKLQEVGRGLRLPVDEKGRRIADEQFYLRYLIDYSEKDFASKLLGEIQA
DTPGQSMNIKKYLTEIAKIRNKSENEIFGELLMKQYIDYDGNIQLEKIDDLYVDYPEAVT
GLKPNKVIDGNKKKNFVKVRQDKFDDISDLWKNINRKYYLKFENISDEELSDAFYNVLKS
DIYIDTTIDVKTRRTVSKDGEIVLRERVANYYLVDDKVAYRDFLKEINRQTGISAKIVHK
TLCKYNDEEGKIDNRLFTNTGITLAVREFNRWLDEKLLKKLSYKPLDVDSKETSLTDYNG
NVLEQVSQGILGIHRDDTVDVPERFIYDSVVYDSPKERQTLLTSDIDEVVVFGKIPRKSI
QIPLFTGGTTSPDFMYVINSEEGGYEMNFVVETKDMDNDKGLRRDEEYRIKSAERFFKTL
KNEGLNVVFKKQLRDDDIVAMIKGISRN
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgaattatccattttgcctcatcaaaatgagtttctgaaagctgttcgaaaa
gcctttgaagatattcgtgttatgtctaatgaagatatccatcaaaattctattattgat
ttagatgataataaaataaaggagaatattaatgatttatggaatggatatcaaggatta
caaaaaatcccaatggcttggcgtacaagagacgatgacgactatctaggtatcgatatt
cgtatggaaacaggtacaggtaagacttattgttatacaagaatgatgtatgagttgaac
gaaatgtatggctttaataagtttattcttctagtgccatcaacgtctattaaagaaggc
agtaagagttttctacaagcagattatagtaatagacatttttcggatttatatcctaat
aaaagtctagaattgtcaatattagagccacagaaaaaaacaaaaggtagaaagatgttt
cctgctgccatatccgagtttgctagaggcacaagtttagagaaaaatagattttctgtt
ctattaatgacctctggtatgcttttgtctaatgcaactatggcgaaggatgattatgac
caaactattttaggtaatttctctcaaccatatgagactttgagagctacgagacctatt
gtaatcattgacgaaccacatcgtttcaaaaaagaaaatcaggcgtaccaaagaatcctt
aaagagctacatccacagtgcattattcgttttggagcaacgtttcctgataaaaaaagt
agtaaggacaaagattataataatcttatttttaatcttggaccaaatcaagcctttaac
caaaatttagttaaaggtgttgagacatttatgattgatgcagaaaggaaaaatgaaact
aaacttaaattgatggatttcaaaagaagtcctaaattatgtacttttagagacgaaatg
acaaaaaaacctatagaattgagtagaggggataatctttctaaatttggtgaagaattt
tcagggataactattgaagaaattggaccaacttcagatgatgcgatcaaaagtggggta
actctatctaatggacaaatattagctaagggtgacgtagtttatggtgggatatatact
gagacttaccaagaacttatgttaaagcaatctattgtcaatcacttagaaacagagaaa
aaaaacttcttacgaggcaataagataaaaactttaagcttgtattttattgattctgta
agatcttatcgagagaaagatgatagacctggtcatttaagaattaaatttgaaagcatg
ttatctgacgcctttaagaaagaaatccgttctataggaaatacgaaagaccagaggttg
caagaatataaatcttatttggaatcttctttagtggaaatctccaaaacaaatggagga
tattttagtgatgatgactctacttcagataaagatatacaaaaagaagttgataaaatc
ctaaggaataaagaggctttattgaatttccatgatgaaacaggtagatggaatactatg
cgttttattttttcaaaatggactttgaaagaagggtgggataaccctaatgtatttcaa
attgttaagttaaggtcatctggttcagaaattagtaaacttcaagaggttgggcgaggg
ctaagacttccagtagatgagaagggaagaagaattgcggatgaacagttctatttaaga
tatcttattgattactcggaaaaagattttgcaagtaaattacttggagaaattcaagca
gatacgccaggacaaagcatgaatatcaaaaaatatcttactgaaattgctaaaattaga
aataagtcagaaaacgaaatatttggcgaattacttatgaaacaatacattgactatgat
ggaaacattcaacttgaaaaaattgatgatttatatgttgattatcctgaagcagtaact
ggacttaaaccaaataaggttattgatgggaataagaagaaaaacttcgttaaagttaga
caggataaatttgatgatattagtgatctttggaaaaatattaatcgaaaatattatttg
aagtttgaaaatatttctgacgaagagttaagtgatgctttttataatgttttaaaatct
gatatatatatagatactaccattgatgtaaaaacgagaagaacagtgtcgaaagatggt
gaaattgtacttcgtgaacgtgtcgcaaattactatcttgttgacgataaggtagcttat
agagatttccttaaagaaattaatagacagacaggtatttctgcaaaaatagttcataag
actttgtgtaaatataacgatgaagaaggaaaaattgataatcgcttatttacaaacact
ggaattactttagcggtaagagaatttaatcggtggttagatgaaaagcttttgaaaaag
ctctcatataagccgttggatgttgattcgaaagaaacaagcttaactgattataatgga
aacgtactagaacaggtatctcaaggtatattaggtattcatcgagatgatactgtcgat
gtaccagaacgctttatttatgatagcgttgtttatgatagtccgaaagagagacagact
cttttaacaagtgatattgacgaagttgttgtatttggaaaaatccctagaaaatctata
caaatcccattattcactggtggaactacaagtcccgactttatgtacgttattaattct
gaagaaggtggatacgaaatgaattttgttgttgaaaccaaggatatggataacgataaa
ggactgaggcgtgatgaagaatacaggattaagtcggcagaaagattctttaaaacatta
aaaaatgaaggtttgaatgtggtctttaagaaacaacttagggatgatgatatcgtggcg
atgattaaggggatttcaagaaattga

DBGET integrated database retrieval system