KEGG   Macrococcus caseolyticus: MCCL_0318Help
Entry
MCCL_0318         CDS       T00848                                 

Definition
(GenBank) arginase homolog
  KO
K01476  arginase [EC:3.5.3.1]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00220  Arginine biosynthesis
mcl00330  Arginine and proline metabolism
mcl01100  Metabolic pathways
mcl01110  Biosynthesis of secondary metabolites
mcl01130  Biosynthesis of antibiotics
mcl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MCCL_0318
   00330 Arginine and proline metabolism
    MCCL_0318
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MCCL_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAH17025
UniProt: B9E9W4
Position
332057..332962
Genome map
AA seq 301 aa AA seqDB search
MNKTIEIIGAPNAFGQRKLGVNMGPDAMRYAGLVERIEAIGHKVVDSGNIESPVIDMKVY
KSEQDGGLRNLPEVTTFCETLCEAVDTSVQNGHYPLVIGGDHSIAMGTISGIAKHYDNLG
VIWYDAHGDLNVADSSPSGNIHGMPLRALIGDGHEDLVNIGGYDKKVKVENIVLIGMRDL
DEGEKSYIKEVGIKTYTMADIDQLGMKTVIEQTLEHLSNCDGIHLSLDVDALDPNETPGT
GTTVPGGITYRESHLAMEMLNDSDRVTSFEIVEVNPLIDINNQTAEQAVGLTGSFFGEKL
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacaattgaaattattggtgcgccaaatgcgttcgggcaacgtaagttaggg
gtaaatatgggaccggatgcaatgcgttatgctggtttagtagagcgcatagaagcaatt
ggacataaggtagtagacagtggaaatattgaatcacctgtaattgatatgaaagtgtat
aaaagcgaacaggacggtggtttaagaaatttaccagaagttactactttttgtgagact
ttatgtgaggctgttgatacatcagtacaaaatggacattatccattagttattggtggt
gatcattctattgcgatgggtacgatatcagggattgcaaagcattatgataatctagga
gtaatctggtatgatgcccatggtgatctgaatgtcgcggattcatcaccttctggcaat
attcacggaatgccgttacgtgcattaattggcgacggccatgaagatttagtgaatatc
ggtggttatgacaagaaagttaaagttgaaaatattgtccttatcggtatgcgtgatctt
gatgagggagaaaagtcgtatattaaagaggtaggtataaaaacctatacgatggcagat
atcgatcagctcggtatgaagacagtgatcgaacagacattagagcatttatcaaattgt
gatggtattcatttatcacttgatgtagatgcactggatccaaatgaaacaccagggaca
ggtactacagttccaggtggtattacgtatcgcgaaagtcatcttgcaatggaaatgcta
aatgacagtgacagagtgacttcgtttgaaatcgtagaagtgaatccattgatagatatt
aataatcaaacagcagaacaagcggtaggactaacgggttcattttttggagagaagttg
ttataa

DBGET integrated database retrieval system