KEGG   Macrococcus caseolyticus: MCCL_0318Help
Entry
MCCL_0318         CDS       T00848                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mcl  Macrococcus caseolyticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCCL_0318
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MCCL_0318
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MCCL_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332057..332962
Genome map
AA seq 301 aa AA seqDB search
MNKTIEIIGAPNAFGQRKLGVNMGPDAMRYAGLVERIEAIGHKVVDSGNIESPVIDMKVY
KSEQDGGLRNLPEVTTFCETLCEAVDTSVQNGHYPLVIGGDHSIAMGTISGIAKHYDNLG
VIWYDAHGDLNVADSSPSGNIHGMPLRALIGDGHEDLVNIGGYDKKVKVENIVLIGMRDL
DEGEKSYIKEVGIKTYTMADIDQLGMKTVIEQTLEHLSNCDGIHLSLDVDALDPNETPGT
GTTVPGGITYRESHLAMEMLNDSDRVTSFEIVEVNPLIDINNQTAEQAVGLTGSFFGEKL
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagacaattgaaattattggtgcgccaaatgcgttcgggcaacgtaagttaggg
gtaaatatgggaccggatgcaatgcgttatgctggtttagtagagcgcatagaagcaatt
ggacataaggtagtagacagtggaaatattgaatcacctgtaattgatatgaaagtgtat
aaaagcgaacaggacggtggtttaagaaatttaccagaagttactactttttgtgagact
ttatgtgaggctgttgatacatcagtacaaaatggacattatccattagttattggtggt
gatcattctattgcgatgggtacgatatcagggattgcaaagcattatgataatctagga
gtaatctggtatgatgcccatggtgatctgaatgtcgcggattcatcaccttctggcaat
attcacggaatgccgttacgtgcattaattggcgacggccatgaagatttagtgaatatc
ggtggttatgacaagaaagttaaagttgaaaatattgtccttatcggtatgcgtgatctt
gatgagggagaaaagtcgtatattaaagaggtaggtataaaaacctatacgatggcagat
atcgatcagctcggtatgaagacagtgatcgaacagacattagagcatttatcaaattgt
gatggtattcatttatcacttgatgtagatgcactggatccaaatgaaacaccagggaca
ggtactacagttccaggtggtattacgtatcgcgaaagtcatcttgcaatggaaatgcta
aatgacagtgacagagtgacttcgtttgaaatcgtagaagtgaatccattgatagatatt
aataatcaaacagcagaacaagcggtaggactaacgggttcattttttggagagaagttg
ttataa

DBGET integrated database retrieval system