KEGG   Macrococcus caseolyticus: MCCL_0325Help
Entry
MCCL_0325         CDS       T00848                                 

Definition
thermostable monoacylglycerol lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mcl  Macrococcus caseolyticus
Brite
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MCCL_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
340385..341122
Genome map
AA seq 245 aa AA seqDB search
MTEIMKGAESYYHQGNNIGILLSHGFTGATFSMMPLAEAYSEAGYTVCLPRLAGHGTNLE
DMAASTYEDWIESIEEGLAKLKETCDTIIMSGLSMGGTLTLYMAAKHPEIKAIIPINAAV
VIPYMHAVAHVDLDIIPGSGSDIKKQGVPEIGYKDTPVKSILEIRKLMRTVEESLFLIKC
PALIFVSLEDHTVPAFNADLIYTSIHSECKHIIETPNSYHMSTLDNDKEFIIEQSLSFVE
TIINS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaataatgaaaggtgcagaaagttattatcaccagggaaataatatagggata
ttgttatcccacggttttaccggggcaacgttcagtatgatgccacttgcagaagcgtac
agtgaggcaggatatacggtatgcttacctcgacttgccggtcacggtacaaacttagag
gatatggcggcttcaacatatgaagactggattgaaagcattgaagaaggactagcaaag
cttaaagaaacatgtgacacaatcattatgtcaggcttatcgatgggagggacgctgacg
ctttatatggcagcgaaacatccggagattaaagcgattattccgattaatgcagcggtt
gttatcccgtatatgcacgcggtagcacatgtggatctcgatattataccgggaagcggt
agtgatattaaaaagcagggtgtacctgaaatcggttataaagatacaccggtgaaaagc
atattagagattcgtaagttaatgcgtactgtagaagaaagtttattcctgattaaatgt
cctgcactgattttcgtaagccttgaagatcatactgtacctgcatttaatgcggatcta
atctatacgtcaattcacagtgagtgcaagcacatcattgaaacaccgaatagttatcat
atgtctacacttgataacgacaaggaattcattatagagcaatcactttcatttgtagaa
acaattataaacagctga

DBGET integrated database retrieval system