KEGG   Macrococcus caseolyticus: MCCL_0351Help
Entry
MCCL_0351         CDS       T00848                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mcl  Macrococcus caseolyticus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCCL_0351
   00052 Galactose metabolism
    MCCL_0351
Enzymes [BR:mcl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MCCL_0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
367651..368619
Genome map
AA seq 322 aa AA seqDB search
MNNKEYKTYTISSNNITIELTNLGAIIKRIMVPHNDQEIDIVLGFDNEQDYLENDSTYFG
AVIGRNANRIEDSIFNIEGTQFHVESNEGNNNLHSGSSGFHTRKWDVVSHNEYSITFSLL
SPHLDQGFPGELKMEVTYALTEDNALEVTYKGQSDRLTVFNLTNHSYFNLNGHDSGDILD
HNLWLNSDKYSELNDESIPTGKQIEATDTNMDFTEMRKISEDKTVEYDDNFILNSNDIHQ
KAAILIGDVTGIQMDVYTNSPCIQLYTGNGLDNVYGKKGTVYNKHAGVCLETQFEPNSIN
SNHPPLIDGEKEYKTIYRFSGF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaataaagaatacaaaacctacacaatttccagtaacaatataaccattgaatta
acaaatctcggtgcaatcattaaaagaatcatggttcctcataatgatcaggaaattgat
attgtcctggggtttgataatgaacaggactacctcgaaaacgattcaacttattttggt
gcagttattggtagaaatgctaatagaatagaggatagtatttttaacatagaaggtaca
caatttcatgttgaatctaatgaaggaaacaataacctgcatagtggttcaagcggtttt
catactagaaaatgggatgttgtatctcataatgaatatagcatcactttttcattactt
agtccgcacttagatcagggatttcccggggaattaaagatggaagtaacatacgcactt
actgaagataatgccttagaagtgacttacaaaggtcaaagtgatagattaactgtgttt
aatctaacgaaccatagttatttcaatttaaatgggcatgattcaggtgacatattagat
cacaatctatggttgaatagtgataaatatagtgaattaaatgatgagagtattcctacg
ggtaaacagatagaagcgacggatacgaatatggactttacagaaatgagaaagatctca
gaagataagacggttgaatatgatgataattttatcttaaatagtaatgacattcatcag
aaagcagcaatacttataggggatgttactggaatacaaatggatgtttatacgaatagt
ccatgtattcagctttataccggaaatggtttggataatgtatatggtaaaaagggtacg
gtttataacaaacatgctggtgtttgtttagaaactcaatttgaaccgaatagtataaat
tcaaatcatccaccgttaattgatggtgagaaagaatataaaacgatttatagattttca
ggtttttaa

DBGET integrated database retrieval system