KEGG   Macrococcus caseolyticus: MCCL_0527Help
Entry
MCCL_0527         CDS       T00848                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mcl  Macrococcus caseolyticus
Brite
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MCCL_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559785..560525
Genome map
AA seq 246 aa AA seqDB search
MKIRLPEPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPHYEGHGVPPEEL
LASSPHVWWSQVLEAYDFLVEKGYNEIAVAGLSLGGVFALKLAQYRDVLAVATMCSPMYI
KTTGNMYEGVLAYASEFKKREGKSKVQIDREMEAFHPTDMLVDLQKTIQDVRDTVDNVYA
PLFVAQGRLDTMINPDSANIIYNEAESDDKEMHWYEQSGHVITIDKEKEQLFEDYYQFLE
QLDWSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagattaccagaaccgttcttttttgaagagggaaaaagagcagttttatta
ttacatgggtttactgggaattcatcagatgtgagacaacttggacgattcctgcagaaa
aaagggtatacaagttatgcaccacactatgaaggtcatggagtacccccagaagaactg
cttgcatctagtcctcatgtatggtggagccaagtcctagaagcttatgatttcttagta
gaaaaaggatataatgaaattgcagtagcaggactatcactcggtggtgtcttcgctttg
aagctggcgcaatatcgtgatgtgttagctgtagctacaatgtgcagcccgatgtatatt
aagacgactggcaatatgtatgagggtgtcctggcgtatgcaagtgagtttaagaaacgt
gaaggtaaatcaaaggtacaaattgatcgtgaaatggaagcttttcatccgacagatatg
cttgtagatttacaaaagacgattcaagatgtccgagatacagtagataatgtatatgcg
ccactgtttgtagctcaaggtagactggatacgatgattaatccggattcggcgaacatt
atctacaatgaagcagaaagcgatgacaaagaaatgcattggtatgaacaaagtggtcac
gttataacaatagataaagaaaaagaacagttatttgaagattattatcagtttttagaa
caattagactggtcaaattaa

DBGET integrated database retrieval system