KEGG   Macrococcus caseolyticus: MCCL_0649Help
Entry
MCCL_0649         CDS       T00848                                 

Definition
UTP-glucose-1-phosphate uridyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mcl  Macrococcus caseolyticus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MCCL_0649
   00052 Galactose metabolism
    MCCL_0649
   00500 Starch and sucrose metabolism
    MCCL_0649
   00520 Amino sugar and nucleotide sugar metabolism
    MCCL_0649
Enzymes [BR:mcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MCCL_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
699475..700344
Genome map
AA seq 289 aa AA seqDB search
MKKVKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEAVAAGIEDIIIVTGKH
KRAIEDHFDNQFELEMALLEKEKFEMLESVRRSTNLANIFYVRQKETKGLGHAIWTAKQF
IGDEPFAVLLGDDIVESDEPAIHQLIAQYDATSKSVIGVQEVDPKNTHRYGIVDPLEQDN
RLYKVNKFVEKPEQGTAPSNLAIMGRYVLTPDIFDYLENQSEGAGGEIQLTDAIERLNRD
DIVYAYNFEGVRHDVGEKFGFVKTTIDFALKNEEMREEVMEYIKRIAQQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtaaaaaaagcgattattcctgctgctggtctcggtacacgattcttgcct
gcaacaaaagcaatgcctaaagaaatgttaccgattcttgataaacctacgatacaatat
atcgttgaagaagctgttgctgcaggtatagaagatattattatcgtgacaggtaagcat
aagcgagcaattgaagaccattttgataatcaattcgaactagaaatggctttacttgag
aaagaaaaatttgaaatgttagagtcagtaagacgttcaactaacctcgctaatattttt
tatgttcgtcaaaaagaaactaagggattaggtcatgccatttggacagcaaaacaattt
attggagatgagccatttgcagtactgcttggcgatgatatcgttgaatctgatgaacca
gcgattcatcaacttattgctcagtatgatgctacatctaaatccgtaattggtgtccag
gaagtagatccaaagaatacacatcgatacggaatagttgatccattagagcaggacaac
agattatacaaagttaataagtttgtagaaaaacctgaacaaggaacggccccttctaat
cttgctattatgggaagatatgtcttgactcctgatatttttgactacctcgaaaatcaa
agtgaaggtgcgggcggagaaatccaactcactgatgcaatagaaaggttaaatcgagat
gatattgtttatgcctataattttgaaggtgttagacatgatgttggagaaaaatttggg
tttgttaaaactactatagattttgccttaaaaaacgaagaaatgcgtgaagaagtaatg
gaatatatcaagagaatcgcgcaacaataa

DBGET integrated database retrieval system