KEGG   Macrococcus caseolyticus: MCCL_0979Help
Entry
MCCL_0979         CDS       T00848                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
mcl  Macrococcus caseolyticus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MCCL_0979
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MCCL_0979
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MCCL_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1076347..1077309
Genome map
AA seq 320 aa AA seqDB search
MMTEVNKSIYLDVARRYYDMQSLYEVVDIVYENEQKELFLHLSDNEAFRVEMNLFKKTPY
KAYSKQEINDLCKYAYERNVMIIPVLDIPSHSGGWLNLLKLNDEERYNKVVSDFDEHTVN
YWDDGEPIKFIKSMIDEIADAFKIPGYKGEQIFHLGMDEVPAAISNQKWLFWFMEHLFKH
VESHNYIPVIWNDQVTPKFLEMALDAGMRDSLRFSYWQQSLKGTVSPDDIMNNFKLYNGN
SYPQTFSAKTLDSKKDMEYMKQHSGIDKFNVIGDITYEAKIRNVCGSLLTLWGEDSESRP
EKEIITELRRMFTAFVQEAK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgaggttaataaatctatatatctagatgtagcaagaagatattacgatatg
caatctttgtatgaagtagtagatattgtatacgaaaatgaacagaaagaactctttctg
cacctatcagataatgaagcatttagggtggagatgaatctttttaagaagacaccttat
aaagcgtattcaaagcaagaaattaatgatctgtgtaaatacgcatatgaacgtaatgta
atgatcatcccagtgttagacataccttcgcattcagggggatggttgaatctactcaaa
cttaatgatgaagagagatacaataaggttgtctctgattttgatgaacacactgtaaac
tattgggacgatggagagcctattaaatttattaagagtatgattgacgagattgcagat
gcattcaaaattcctggatataaaggggaacagatatttcaccttggaatggatgaggtg
cctgctgctataagtaatcaaaaatggcttttttggtttatggaacatcttttcaagcac
gttgaatctcacaactatataccggtgatatggaacgatcaagtaaccccaaagtttcta
gaaatggctttagatgctgggatgagagacagtttaagattcagttattggcaacaaagc
ctaaaaggtactgtatctcctgatgatataatgaataacttcaaactctataacggaaac
tcttaccctcagacgttcagcgcaaagacgttagattcgaagaaggatatggaatacatg
aaacagcattcagggattgataaatttaatgttataggagacataacgtatgaagcaaaa
ataagaaatgtttgtggctcgttacttacgctatggggagaggattcagaatctcgtcca
gaaaaggaaattatcacagaactaagaagaatgtttaccgcattcgtacaggaagctaaa
tag

DBGET integrated database retrieval system