KEGG   Macrococcus caseolyticus: MCCL_0986Help
Entry
MCCL_0986         CDS       T00848                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mcl  Macrococcus caseolyticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCCL_0986 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCCL_0986 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MCCL_0986 (thrC)
Enzymes [BR:mcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MCCL_0986 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1086348..1087424
Genome map
AA seq 358 aa AA seqDB search
MKVYRMNRWSGLIAEYKHFLPVSEATPKLTLNEGGTPLIHCAHLSEVLENEVYVKYEGAN
PTGSFKDRGMVMAVAKAKEEGKEIVICASTGNTSASAAAYAARAGMKTIVVIPEGKIAMG
KLAQAIVYGADIVSIEGNFDEALKIVRHVAEKRDDIALVNSVNPYRLEGQKTAAFEVIEQ
LGQVPDVLAIPVGNAGNISAYWKGFKEYDANHNIGLPKMYGFQAEGAAPIVKGRIIEQPE
TIATAIRIGNPASWRLAEAARDESEGMIDAVTDDEILEAYDLIAKKEGIFAEPGSNASIA
GLLKLKREGRLSKGQTIVAVLTGNGLKDPQTAIDSIEIQPAVLKNDESAIIRYIEERV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtgtatagaatgaacagatggtcagggttaatcgcagaatataagcatttttta
cccgtaagtgaggcaacaccgaaactcacattaaatgaaggaggtacgccattgatacat
tgtgctcatctttcagaggttcttgaaaatgaagtatatgtgaaatatgaaggggcgaat
cctacaggttcatttaaagaccgcggtatggttatggctgtagcaaaagctaaggaagag
ggaaaagagattgtcatttgcgcttctacgggtaacacttcagcttcagcagctgcctat
gctgcaagagctggaatgaaaacgattgtagtaattccggaagggaagatagctatgggt
aaattggctcaggcaatcgtttatggtgctgatatcgtttctatcgaaggtaactttgat
gaagcattgaagatcgtaagacatgttgcagaaaaacgtgatgatatcgcactggtaaac
tccgttaatccatatcgacttgaaggtcagaagacagctgcttttgaagtgatcgaacag
ctcggacaagttccggatgtgttagcgattcctgttggaaatgctggtaatatttcggca
tactggaaggggtttaaagaatatgatgcaaatcataacattggtttaccaaaaatgtat
ggtttccaggcagaaggtgctgcaccgattgtaaaaggacgtattatcgagcagccagaa
acgattgctactgcgattcgtatcggaaatccagcaagctggaggctcgcagaagcagca
cgcgatgaatcggaaggcatgatagatgctgtaacagatgatgagatactagaagcatat
gatttaattgcaaagaaagaaggtatctttgctgaaccaggcagcaatgcaagtatcgct
ggtctgttaaagttaaaacgtgaaggtcggctgtcaaaggggcagacgattgttgcagta
ttaaccggaaatgggcttaaagacccacagactgcgattgattcaattgaaatacagcct
gctgtactgaagaacgatgaatcagcgattattagatacattgaggagcgagtataa

DBGET integrated database retrieval system