KEGG   Macrococcus caseolyticus: MCCL_1063Help
Entry
MCCL_1063         CDS       T00848                                 

Gene name
odhB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00020  Citrate cycle (TCA cycle)
mcl00310  Lysine degradation
mcl01100  Metabolic pathways
mcl01110  Biosynthesis of secondary metabolites
mcl01120  Microbial metabolism in diverse environments
mcl01130  Biosynthesis of antibiotics
mcl01200  Carbon metabolism
Module
mcl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCCL_1063 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    MCCL_1063 (odhB)
Enzymes [BR:mcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCCL_1063 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: BAH17770
UniProt: B9EC09
Position
complement(1173409..1174656)
Genome map
AA seq 415 aa AA seqDB search
MAEIRVPELAESITEGTISTWFKQVGDSVEKGENIVELETDKVNVEVISEEAGVITELKA
AEGDTVEVGSVIAIVEAGGTQKASNDASQQETSTHEEQSEHKEVKSEEEAGAADSSSERI
VATPSARRYARENGIDLSDVNSKDPRGLIRSHDVKNSQSAPSQSAAEQKPEAPKQTASNP
EKPVIREKMSRRRQTIAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKDKFQEDHNGTR
LGFMSFFTKAVVAALKKYPAVNAEIDGDDLILKQFYDIGVAVSTEEGLVVPVVRDCDKKN
FAEIEGSIYDLAVKARDKKLSLDDMMGGSFTITNGGVFGSLMSTPIINGTQAAILGMHSI
VTRPVAIDKERMENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIESPEDLLLES
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaaatcagagttccagaattagcagaatcaataacagaaggtacgatctcgact
tggttcaaacaagttggagacagtgttgaaaaaggcgaaaatatcgtagaacttgaaaca
gataaagtgaatgttgaagttatctcagaagaagcgggggttattacagaacttaaagcg
gctgaaggtgatacagttgaagtaggttcggtcattgcaattgttgaagctggtggaaca
caaaaagctagtaatgatgcatctcagcaagaaacatcaacacatgaagaacagtcagaa
cataaagaagtaaagtctgaggaggaagctggagctgctgatagttcatccgaacgcatc
gtagctacaccgtctgcacgacgctatgcacgtgaaaatggtatcgatttaagtgatgta
aatagtaaggatccacgaggacttattcgttcacatgatgttaaaaattcacaatcagca
ccttctcaatcagcagcggaacaaaaaccagaggcaccaaaacaaacggcatctaatccg
gagaaacccgtaataagagaaaagatgtctcgtcgtcgtcagactatcgcaaagaaattg
ttggaagtatctaacaatactgcgatgttaacgaccttcaacgaagtagatatgacgaat
gttatggaacttcgtaagcgcaaaaaagataagtttcaggaagatcataatggaacgcgt
ctaggatttatgtcattctttacgaaagctgttgtagcagcacttaagaaataccctgct
gtaaatgctgaaattgatggagatgacttaatcttaaagcaattctatgatattggtgtc
gctgtttctactgaagaaggattagtagtacccgtcgttcgtgattgtgataagaagaac
ttcgctgaaatagaaggaagtatctatgatcttgccgtcaaagcgagagataagaaacta
tccttagatgatatgatgggtggttcatttacaatcacaaatggtggtgtattcggttca
ttgatgtctacgccaatcattaacggaacacaagcagctattttaggaatgcattcgatt
gttactcgacctgttgcaattgataaagaacgtatggaaaatcgtccgatgatgtatatc
gcattaagctacgatcatagaatcatcgacggtaaagaagctgttggattcttaaagaca
ataaaagagctgatcgaaagccctgaagatttattgcttgaaagctaa

DBGET integrated database retrieval system