KEGG   Macrococcus caseolyticus: MCCL_1063Help
Entry
MCCL_1063         CDS       T00848                                 

Gene name
odhB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcl  Macrococcus caseolyticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCCL_1063 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCCL_1063 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    MCCL_1063 (odhB)
Enzymes [BR:mcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCCL_1063 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1173409..1174656)
Genome map
AA seq 415 aa AA seqDB search
MAEIRVPELAESITEGTISTWFKQVGDSVEKGENIVELETDKVNVEVISEEAGVITELKA
AEGDTVEVGSVIAIVEAGGTQKASNDASQQETSTHEEQSEHKEVKSEEEAGAADSSSERI
VATPSARRYARENGIDLSDVNSKDPRGLIRSHDVKNSQSAPSQSAAEQKPEAPKQTASNP
EKPVIREKMSRRRQTIAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKDKFQEDHNGTR
LGFMSFFTKAVVAALKKYPAVNAEIDGDDLILKQFYDIGVAVSTEEGLVVPVVRDCDKKN
FAEIEGSIYDLAVKARDKKLSLDDMMGGSFTITNGGVFGSLMSTPIINGTQAAILGMHSI
VTRPVAIDKERMENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIESPEDLLLES
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
ttggctgaaatcagagttccagaattagcagaatcaataacagaaggtacgatctcgact
tggttcaaacaagttggagacagtgttgaaaaaggcgaaaatatcgtagaacttgaaaca
gataaagtgaatgttgaagttatctcagaagaagcgggggttattacagaacttaaagcg
gctgaaggtgatacagttgaagtaggttcggtcattgcaattgttgaagctggtggaaca
caaaaagctagtaatgatgcatctcagcaagaaacatcaacacatgaagaacagtcagaa
cataaagaagtaaagtctgaggaggaagctggagctgctgatagttcatccgaacgcatc
gtagctacaccgtctgcacgacgctatgcacgtgaaaatggtatcgatttaagtgatgta
aatagtaaggatccacgaggacttattcgttcacatgatgttaaaaattcacaatcagca
ccttctcaatcagcagcggaacaaaaaccagaggcaccaaaacaaacggcatctaatccg
gagaaacccgtaataagagaaaagatgtctcgtcgtcgtcagactatcgcaaagaaattg
ttggaagtatctaacaatactgcgatgttaacgaccttcaacgaagtagatatgacgaat
gttatggaacttcgtaagcgcaaaaaagataagtttcaggaagatcataatggaacgcgt
ctaggatttatgtcattctttacgaaagctgttgtagcagcacttaagaaataccctgct
gtaaatgctgaaattgatggagatgacttaatcttaaagcaattctatgatattggtgtc
gctgtttctactgaagaaggattagtagtacccgtcgttcgtgattgtgataagaagaac
ttcgctgaaatagaaggaagtatctatgatcttgccgtcaaagcgagagataagaaacta
tccttagatgatatgatgggtggttcatttacaatcacaaatggtggtgtattcggttca
ttgatgtctacgccaatcattaacggaacacaagcagctattttaggaatgcattcgatt
gttactcgacctgttgcaattgataaagaacgtatggaaaatcgtccgatgatgtatatc
gcattaagctacgatcatagaatcatcgacggtaaagaagctgttggattcttaaagaca
ataaaagagctgatcgaaagccctgaagatttattgcttgaaagctaa

DBGET integrated database retrieval system