KEGG   Macrococcus caseolyticus: MCCL_1259Help
Entry
MCCL_1259         CDS       T00848                                 

Definition
(GenBank) exodeoxyribonuclease V alpha subunit homolog
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCCL_1259
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MCCL_1259
DNA repair and recombination proteins [BR:mcl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MCCL_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA UvrD_C Helicase_RecD T2SSE AAA_22 AAA_16 NTPase_1 AAA_18 DUF2075 NACHT Zeta_toxin Mg_chelatase AAA_28 AAA_12 TsaE RsgA_GTPase AAA_33
Motif
Other DBs
NCBI-ProteinID: BAH17966
UniProt: B9E6Z8
Position
complement(1360287..1362677)
Genome map
AA seq 796 aa AA seqDB search
MENMTLFEQSFVKGTITRILFYNNDNFYTVLKAEVIESNEDFDDDATITGYLPQIAEGDT
YTFTGKIITHPKYGKQLQADKFEKDMPQSRDGIIHYLSSDLFKGVGKKTARTIVEVLGED
ALNIILDDKSSLDQVPKLSDEKKELIYSTIHDNQAIEKIMIQLNEFGFGPQLAMKIYQFY
KDDTLKVINESPYQLVMDIEGIGFNKADELAGKLGIDNNHPERLKAALVFTIEQASNQNG
HTYIPDQVLLETSFNLLTKNGSQVNPDRLVIALTELTEEHKLVEHEKNIYIPSLFYSETK
AVQILHRLMNHKNQVKEFEQSEVLMAIGELEALFEVSYAERQKDALITAMNSKLMILTGG
PGTGKTTVVRGIVNLYAELHGLSLDYDDYDGQDYPIVVAAPTGRASKRLQESTGLEATTI
HRLIGWTKENKPDDVLETEITAKLVIIDEMSMVDTWLMFQLMKAVPDDAQIIFVGDQDQL
PSVGPGQVFKDMIDAHIMPQIELNEVYRQQEGSSIVELAHQIKRNEPFDIKKRYNDRSFI
PCTSNQIPEVIEKIVRSAVNKGYDMRDIQVLAPIYRGPAGIRALNKVLQEILNPSDENKR
ELQFGDVYFRTGDKVLQLVNRPEDNVFNGDIGEVTGIFMAAENALNKDVVIVDYDGSEVT
YTKADLMEITHAYCCSIHKSQGSEFPIVIMPVVNQYYRMLQKNILYTGLTRAKQSLIFCG
DVHAFNEGIKRIGNTRFTSFYQFLIDYFNEDEINDKKQDDQGNILPFNVGEMTEDNMHLV
DPMINMEGITPYDFIS
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaatatgactttgtttgagcaatcctttgtaaaagggacaataacgagaatatta
ttctataacaatgataatttctatactgtgctgaaggctgaagtgattgaatcaaatgaa
gattttgatgatgatgctacgattacaggttatctcccacaaattgcagaaggcgataca
tatacttttaccggtaagattataacgcatccgaagtatggaaagcagctccaggcggat
aaatttgagaaggatatgccacagtcgcgtgacggtattattcattatttatcaagtgat
ttgtttaaaggagtcggtaagaaaacagcgagaacgattgtagaagtgcttggtgaagat
gcactgaacattattcttgatgataaaagtagtcttgaccaggtaccgaagttatcagat
gagaagaaagaattaatctatagcacgattcatgataatcaggcgattgagaaaatcatg
attcagctgaatgaatttgggttcgggccgcagcttgcgatgaagatttatcagttctat
aaggacgatacgctgaaggtgattaatgaatctccgtatcaactcgtgatggatattgaa
gggatcggatttaataaagcggatgaactggcagggaaactcggtatcgataacaatcac
ccagagcgtctgaaagcagcgctcgtgtttacgatagaacaagcctctaaccagaatgga
cacacatatattccggaccaggtattacttgaaacaagcttcaatctactgacgaaaaat
ggcagtcaagtcaatcctgatcgcctcgttatcgcactcactgaactgacagaggaacat
aagctcgttgaacatgagaagaacatctatattccaagtctattctattctgaaacaaaa
gctgtacaaatattgcatcgattaatgaaccataagaatcaggtgaaagagttcgaacag
tcagaagtattgatggcaatcggagaactggaagcactgtttgaagtcagctatgcagaa
cggcagaaagatgcgcttattacggcgatgaactctaagctgatgatattaacgggtggg
cctggtacaggaaagacgacagtcgtacgtggtattgttaatttatatgccgagctgcat
ggcttaagtctagattatgatgactatgacggacaggactatccgattgtcgtcgcagca
ccgactggtcgtgcgtcaaagcgtcttcaggaatcgacgggacttgaagcgacgacgata
cacaggttaattggatggacgaaagaaaataaaccggacgacgtgctggaaaccgaaatt
acagcgaaactggtcattattgatgaaatgtcaatggttgatacgtggcttatgtttcaa
ttgatgaaggctgtaccagacgatgcccagattatatttgtcggtgaccaggaccagctt
ccttcggtcggtccaggtcaagtatttaaggatatgattgatgcacacattatgcctcag
attgaactgaacgaggtgtatagacagcaggaaggttcctcgattgtcgaactagcacat
cagattaagcgcaatgaaccttttgacattaagaaaagatataatgacagaagttttata
ccgtgtacaagcaaccaaattccggaagtgattgagaaaattgtacgcagcgctgtgaat
aaagggtacgatatgcgtgacatacaagtactcgcaccgatatatagggggccagcaggt
atacgtgcattgaataaagtattgcaggaaatactgaatccaagcgatgaaaacaaacgt
gaactgcaatttggtgatgtttatttcagaacgggtgataaagttttgcagcttgtcaat
cgacctgaagataatgtatttaatggtgatattggagaagtcactggtatatttatggca
gctgagaatgcattaaataaagatgttgtgattgttgactatgatggcagtgaagtaacg
tatacgaaagcagatttaatggaaattacacatgcatattgctgttctattcataagtcc
caaggttcggaatttccgatagtaatcatgcctgttgtcaatcagtactacagaatgttg
cagaagaatattctgtatacgggattaacacgtgcaaaacaatccctaatattctgtgga
gatgttcacgcttttaatgaaggaattaagcgtatcggtaatacaaggtttacaagcttc
tatcagtttctaatcgattattttaacgaagacgaaataaatgacaaaaagcaagatgac
caaggtaatatactacctttcaacgtgggggagatgactgaagacaatatgcatcttgtt
gatccgatgatcaatatggaaggtataacaccatatgattttataagttga

DBGET integrated database retrieval system