KEGG   Macrococcus caseolyticus: MCCL_1288Help
Entry
MCCL_1288         CDS       T00848                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mcl  Macrococcus caseolyticus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MCCL_1288
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MCCL_1288
Enzymes [BR:mcl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MCCL_1288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1393754..1394893)
Genome map
AA seq 379 aa AA seqDB search
MKHNHFILILLIPVFLILTACTNHKIAKAQHPIVEIQKLSHVDLTTYYVSSMTLEEKIAQ
QLVLGFDGTDYNAALKRYSARNIGGVILFKRNIVNESQLTQLNRDIFHNAANIPMFIGID
QEGGRVNRLPASIQNIESAYTIGLSHDKQYAYQQGRYIGENVKRMGFNLDFAPVLDIWSN
PANKVIGDRSFGHDAHMVSGMSRSFRQGITETGIITSGKHFPGHGDTVSDSHETLPVSNK
SLDELMKFELIPFKQHIDDGIDMLMVSHISFPDIDNKYPASISKEIVTNILKKKLGYKGV
IISDDLSMGAISDRYSLNEAVVRGLQSGETIMLIGSDAVDVDTLIQYVRSNVENGNIDKK
IIDENNEKIIRLKLKYGIL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaaacataatcactttattttgattctacttatccctgtctttttaatattaactgca
tgcactaaccataaaatagctaaggcacagcatcctattgttgaaatacagaagttatca
catgttgatctgacgacttattatgtaagttcgatgacgcttgaagaaaagatagcgcaa
cagcttgtgctgggctttgacggcacggattataatgcagctttaaaaagatattccgct
cgcaatattggtggtgttattttgtttaagagaaatatagtgaatgaatctcagttaacg
caactgaatcgggatatctttcacaatgctgctaatataccgatgtttatcggaatagat
caggaaggaggtagagtaaaccgattgccggcttctatacaaaatattgaatccgcctat
acgataggtttatcgcatgataaacagtatgcatatcagcaaggtagatatattggagaa
aatgtgaaacgtatgggatttaatctggattttgcacctgtactggatatttggagcaac
ccagcgaataaagtaattggagatagaagctttggtcacgatgcacacatggtttcggga
atgagccgttcgtttcgtcaaggaataaccgagacaggaatcattacgagtggtaaacat
tttccagggcatggagatacagtttcagacagtcacgagacacttcctgtgagcaataaa
tcacttgatgagcttatgaagtttgaactgattcctttcaaacaacatattgatgatggc
atcgatatgctgatggtcagccatatttcatttccagatatcgataataagtatccggca
tctatcagtaaagaaattgtgaccaatatattaaagaagaagctcggatataaaggcgtt
atcatttcagatgatctaagtatgggtgcaatcagcgatcgctattccttgaatgaagca
gttgttcgtgggttgcagtcgggtgagacaatcatgcttatcggaagtgatgctgtagat
gttgatacactgattcaatatgtcagatcaaatgttgaaaacggcaatatagataaaaaa
ataattgatgaaaataatgaaaaaataatcagattaaagcttaaatatggtatcttataa

DBGET integrated database retrieval system