KEGG   Macrococcus caseolyticus: MCCL_1338Help
Entry
MCCL_1338         CDS       T00848                                 

Definition
(RefSeq) hypothetical protein
  KO
K02303  
uroporphyrin-III C-methyltransferase [EC:2.1.1.107]
Organism
mcl  Macrococcus caseolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCCL_1338
Enzymes [BR:mcl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     MCCL_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1450941..1451945)
Genome map
AA seq 334 aa AA seqDB search
MDLGKVYFIGAGPGDPGLVTYKAIRKIEQADVIIYDRLVNPILLQLSKRDCKLIYVGKNP
DVKYKKQDEINTIINHCAQQYKTIVRLKGGDPGIFGRLTEEVESLDDHTPYEIVPGITSA
SAAALYSGFPLTDRAYSPHVTFSTGHLQKDSVREIDFEALAKGGTLALYMGMKALPEIVA
VLSKNEAHLKIAVIGHASYGFQKTVTGDLTNIIQKVQEEEVTHPAMIIIGDVVNCRKGVS
WFESLPEFNEAHLYISTDEINKHELIERFEQGGFYYAIDQMNDALVQEKYRNVHVDVLSE
RTFTQVFAFSTQALQLFEETYGIQFNRNIINIKG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatctaggcaaagtttactttatcggtgcaggaccaggtgatcctggtcttgttact
tataaggcaatacgtaaaatcgagcaggcagatgtgattatatatgatcgtcttgtaaat
ccaatattactgcagctcagcaagcgcgactgcaaactgatatacgttggtaagaatcct
gacgtaaaatataagaagcaggatgaaatcaatacaatcattaatcattgtgcacagcag
tataagactattgtccgtctaaaaggtggggacccaggtatattcggtcgcctgactgaa
gaagtagaaagtctggacgaccatacgccatacgagattgttccagggattacaagcgca
tcagctgcagcgctctattcaggcttcccactgacggaccgtgcatattcaccgcatgtt
acgttttcaacgggtcatctgcaaaaagacagcgtcagagaaattgattttgaagcactc
gcgaaaggtggaacacttgcactgtatatggggatgaaagcattacctgaaatcgtagca
gtattatctaaaaatgaagctcatctaaaaatagcagtaattggacatgcaagttatggc
ttccagaagacggttacaggagatttaacaaatattatccagaaagttcaggaagaagag
gttacacatccggcaatgattattattggtgacgttgtgaactgcagaaaaggggtatca
tggtttgaatccctacctgaatttaatgaagcccatctctatataagtacagatgaaatc
aataagcatgaacttatcgaacgatttgagcaaggtggattttattacgcaatcgaccag
atgaatgacgcattggtacaagaaaagtacagaaacgtacatgttgatgtattaagcgaa
agaacttttacgcaagtatttgcattcagtactcaagcgctacaattatttgaagaaacg
tatggcatacaatttaatcgcaacatcattaatattaaaggctga

DBGET integrated database retrieval system