KEGG   Macrococcus caseolyticus: MCCL_1365Help
Entry
MCCL_1365         CDS       T00848                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00010  Glycolysis / Gluconeogenesis
mcl00030  Pentose phosphate pathway
mcl00051  Fructose and mannose metabolism
mcl00052  Galactose metabolism
mcl00680  Methane metabolism
mcl01100  Metabolic pathways
mcl01110  Biosynthesis of secondary metabolites
mcl01120  Microbial metabolism in diverse environments
mcl01130  Biosynthesis of antibiotics
mcl01200  Carbon metabolism
mcl01230  Biosynthesis of amino acids
mcl03018  RNA degradation
Module
mcl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcl_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCCL_1365 (pfk)
   00030 Pentose phosphate pathway
    MCCL_1365 (pfk)
   00051 Fructose and mannose metabolism
    MCCL_1365 (pfk)
   00052 Galactose metabolism
    MCCL_1365 (pfk)
  Energy metabolism
   00680 Methane metabolism
    MCCL_1365 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MCCL_1365 (pfk)
Enzymes [BR:mcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MCCL_1365 (pfk)
Protein phosphatases and associated proteins [BR:mcl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MCCL_1365 (pfk)
Messenger RNA biogenesis [BR:mcl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MCCL_1365 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAH18072
UniProt: B9E7A4
Position
complement(1480477..1481436)
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRKAMYYDIEVYGVYQGYQGLINNNIKKMERGTVGDK
IQRGGTFLQSARCPEFKDPEVRKQAIANLNNLGIEGLVVIGGDGSYRGAQRLNEEGIKTI
GIPGTIDNDINGTDFTIGFDTALNTIVEAIDKIRDTASSHERTFIVEVMGRDAGDLALWS
GLAGGAETVLCPEHRKDVKVIADKIQQGIERGKKHSIIVVAEGVMTGEECGQELKKYINV
DTRISVLGHMQRGGSPSGMDRVLASRLGGYAVELLMNDETGLAVGIQNNSLSKTKFEDIF
TSVHHLDEKMYELSNELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagctgtgttaacgagtggtggcgatgcacctggaatgaatgctgctgtt
cgtgctgttgtgcgtaaagcaatgtattacgacatagaagtttatggcgtatatcaaggg
tatcagggattaatcaataataatatcaagaagatggaacgtggcactgtaggggataag
atacagcgtggggggacatttctgcaatcggcacgttgtccagaatttaaagatccagaa
gtacgcaagcaggcgattgccaatttaaataatcttggcattgaaggtctggtggttatt
ggtggcgatggaagttatcgtggcgctcaaagactgaatgaagaaggcattaagacaatc
ggtataccaggaacgattgataatgatattaatggcacagactttacgataggatttgat
acggctttaaatacgattgtagaagcaattgataagattagagatacggcgtcgagtcat
gaacgtacattcatcgtagaagtaatgggtagagatgcaggagacctagcactgtggtct
ggtcttgcaggcggtgctgagacagtattatgtccggagcatcgtaaagatgtcaaggtc
attgcagataaaattcaacaagggatcgaacgtggcaaaaaacattctatcatcgttgtt
gctgaaggcgttatgaccggtgaagaatgtggtcaggaactaaagaaatatattaatgtt
gatactcgtatatcggtacttggtcatatgcagcgtggaggctcaccttctggaatggat
agagtgcttgcaagtcgtcttggtggttacgctgtagaactactgatgaatgatgaaact
ggtctggcagttggtattcagaataatagtttatctaagactaagtttgaagacatcttc
acatctgtccatcatttagatgagaagatgtatgaattatctaatgaattatcgatataa

DBGET integrated database retrieval system