KEGG   Macrococcus caseolyticus: MCCL_1365Help
Entry
MCCL_1365         CDS       T00848                                 

Gene name
pfk
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcl  Macrococcus caseolyticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:mcl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mcl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mcl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mcl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:mcl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1480477..1481436)
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAVRAVVRKAMYYDIEVYGVYQGYQGLINNNIKKMERGTVGDK
IQRGGTFLQSARCPEFKDPEVRKQAIANLNNLGIEGLVVIGGDGSYRGAQRLNEEGIKTI
GIPGTIDNDINGTDFTIGFDTALNTIVEAIDKIRDTASSHERTFIVEVMGRDAGDLALWS
GLAGGAETVLCPEHRKDVKVIADKIQQGIERGKKHSIIVVAEGVMTGEECGQELKKYINV
DTRISVLGHMQRGGSPSGMDRVLASRLGGYAVELLMNDETGLAVGIQNNSLSKTKFEDIF
TSVHHLDEKMYELSNELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagctgtgttaacgagtggtggcgatgcacctggaatgaatgctgctgtt
cgtgctgttgtgcgtaaagcaatgtattacgacatagaagtttatggcgtatatcaaggg
tatcagggattaatcaataataatatcaagaagatggaacgtggcactgtaggggataag
atacagcgtggggggacatttctgcaatcggcacgttgtccagaatttaaagatccagaa
gtacgcaagcaggcgattgccaatttaaataatcttggcattgaaggtctggtggttatt
ggtggcgatggaagttatcgtggcgctcaaagactgaatgaagaaggcattaagacaatc
ggtataccaggaacgattgataatgatattaatggcacagactttacgataggatttgat
acggctttaaatacgattgtagaagcaattgataagattagagatacggcgtcgagtcat
gaacgtacattcatcgtagaagtaatgggtagagatgcaggagacctagcactgtggtct
ggtcttgcaggcggtgctgagacagtattatgtccggagcatcgtaaagatgtcaaggtc
attgcagataaaattcaacaagggatcgaacgtggcaaaaaacattctatcatcgttgtt
gctgaaggcgttatgaccggtgaagaatgtggtcaggaactaaagaaatatattaatgtt
gatactcgtatatcggtacttggtcatatgcagcgtggaggctcaccttctggaatggat
agagtgcttgcaagtcgtcttggtggttacgctgtagaactactgatgaatgatgaaact
ggtctggcagttggtattcagaataatagtttatctaagactaagtttgaagacatcttc
acatctgtccatcatttagatgagaagatgtatgaattatctaatgaattatcgatataa

DBGET integrated database retrieval system