KEGG   Macrococcus caseolyticus: MCCL_1409Help
Entry
MCCL_1409         CDS       T00848                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mcl  Macrococcus caseolyticus
Pathway
mcl00010  Glycolysis / Gluconeogenesis
mcl00620  Pyruvate metabolism
mcl00640  Propanoate metabolism
mcl00680  Methane metabolism
mcl01100  Metabolic pathways
mcl01110  Biosynthesis of secondary metabolites
mcl01120  Microbial metabolism in diverse environments
mcl01130  Biosynthesis of antibiotics
mcl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCCL_1409 (acsA)
   00620 Pyruvate metabolism
    MCCL_1409 (acsA)
   00640 Propanoate metabolism
    MCCL_1409 (acsA)
  Energy metabolism
   00680 Methane metabolism
    MCCL_1409 (acsA)
Enzymes [BR:mcl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MCCL_1409 (acsA)
Lipid biosynthesis proteins [BR:mcl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MCCL_1409 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAH18116
UniProt: B9E7E8
Position
complement(1528198..1529940)
Genome map
AA seq 580 aa AA seqDB search
MKTITQGDFKMKTEIFEAVQGNHNLSNYEEVYNNFDWKEVEKNFSWHNTGKVNMAYECID
KHVDNGKGDKVALYYKDVNREESYTFEEMQRNSNKAANVLVQEADVKKGDRVFIFMPRSP
ELYFAFLGVLKIGAIVGPLFEAFMEKAVRDRLENSEASVIITTKSLLGRIPKDELPHLKH
IVVVDEDVEEGYIDFNKRFESASEEFEIEWLNLDDGLILHYTSGSTGQPKGVLHVQNAMI
QHYISGYYVLDLKEDDIYWCTADPGWVTGTSYGIFAPWLNGVTNVIAGGRFSPEGWYKTI
QQFKVTVWYSAPTAFRMLMGAGDEVINKYDLSSLRHILSVGEPLNPEVIKWGHNVFKLRI
HDTWWMTETGGHMIVNYPAMDIKSGSMGKPLPGVIAAIVDNEGNELPPNRMGNLAMKSGW
PSMMKEIWNNEAKYKSYFLPGDWYISGDSAYMDEEGYFWFQGRVDDVIMTAGERVGPFEV
ESKLVEHPAVQEAGVIGKPDPVRGEIIKAFIALREGYEATDELKEEIRMFVKDGLAAHAA
PREIEFKDKLPKTRSGKIMRRVLKAWELDLPTGDLSTMED
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgattacacagggggattttaaaatgaagacagaaatttttgaggcagtgcaa
ggtaatcataatctatctaactacgaggaagtgtataacaactttgactggaaggaagtt
gagaagaacttctcatggcataatacaggaaaagttaatatggcttatgaatgtattgat
aaacatgtagataatggcaaaggggacaaagtcgcattatactacaaagatgtaaatcgc
gaggaatcatatacctttgaagagatgcagcgcaattcaaataaggctgcgaatgtactc
gttcaggaagcggatgtcaaaaaaggagaccgtgtatttatctttatgccacgctctcct
gaactttactttgcttttttaggtgttcttaaaattggtgctatcgtaggtcctttattc
gaagcattcatggagaaagcagtacgtgatcgcttagagaatagtgaagcaagtgtcatc
attacaacgaaaagtttactcggacgtatacctaaagatgaattaccacacttaaaacat
attgttgtagtagatgaagatgtagaagaaggatatatcgatttcaataaaagatttgag
tctgcatcagaggaatttgaaattgaatggctgaaccttgatgatggtttaattcttcat
tatacgtctggttcaactggacagccaaaaggagtgcttcatgttcaaaatgcaatgatt
cagcactatatttcaggatattatgtattagatcttaaagaagatgatatctactggtgt
acagcagatccaggctgggttacagggacgagctacggtatatttgcaccatggttaaac
ggtgtgacgaatgtaattgcaggaggaagattctcgccagaaggatggtacaagacgata
cagcaatttaaagtgacagtgtggtattcagcaccgacagcattccgtatgttaatgggt
gcaggggatgaagtgattaacaaatatgatctttcgagtttacgtcatatattatctgtc
ggtgaaccactgaatccggaagtgattaaatggggacacaacgtgtttaaactgcgtatc
catgatacgtggtggatgacagaaacaggaggccatatgattgtaaactatcctgccatg
gatattaagtccggatcgatggggaaaccgttacctggtgttattgcagcaattgttgat
aatgaaggtaacgagcttccgccaaaccgtatggggaacttagcgatgaaatcagggtgg
ccatctatgatgaaagaaatatggaataatgaagcgaagtataaatcatatttcttacca
ggagactggtatatttcgggtgattctgcatatatggatgaagaaggttacttctggttc
cagggacgtgtggatgatgttattatgacagcaggagaacgtgtcggtccatttgaagta
gaatctaagcttgtggagcacccagcggtacaagaggcgggtgttatcggaaagccggat
ccagttcgtggggaaattattaaagcatttattgcactgcgtgaaggttatgaagcaaca
gatgaactgaaagaagaaattcgcatgtttgtaaaagatgggcttgcagcacatgctgca
cctcgagaaatcgagtttaaagataagttgccgaagacacgttcaggtaagattatgaga
cgtgtacttaaagcgtgggaactggatttaccgacgggtgatttaagtacgatggaagat
taa

DBGET integrated database retrieval system