KEGG   Macrococcus caseolyticus: MCCL_1594Help
Entry
MCCL_1594         CDS       T00848                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  
glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
mcl  Macrococcus caseolyticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCCL_1594
Enzymes [BR:mcl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     MCCL_1594
Amino acid related enzymes [BR:mcl01007]
 Aminotransferase (transaminase)
  Class III
   MCCL_1594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1727030..1728316
Genome map
AA seq 428 aa AA seqDB search
MNFSNSEAIQNRANAAILGGVNSPSRSYKAVGGGAPVVMARGEGAYFYDVDGNKYIDYLA
AYGPIITGHAHPHITEAIKRAAENGVLYGTPTEHEVVFAEMLQEAIPSLEKVRFVNSGTE
AVMTTIRVARAYTGRDKIIKFAGCYHGHSDLVLVAAGSGPSQLGTPDSAGVPKSVAQEVI
TVPFNDIEQFKEAFYHFGDQIAGVLVEPIVGNFGIVEPHAGFLEAVNEVAHSHGALVIYD
EVITAFRFCYGGAQDMLGVKPDLTAFGKVIGGGLPIGAYGGRQDIMEHVAPLGPTYQAGT
MAGNPLSMQAGIALLEVIKAEGTYDYLDKLGEMLETGMNELIEKYSIKANINRLKGAMTI
YFTDEKVENYEQAEATDGEAFAKFFKLMLHQGINLAPSKYEAWFITIAHTEQDIQDTLIA
VENSFKQM
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaactttagtaattcagaagcaatacaaaatcgtgcaaatgccgcaattcttggcggt
gttaactcaccttctcgttcttataaagcagttggtggcggtgcgcctgtagtgatggcc
cgtggcgaaggtgcttacttctacgatgtggatggtaataaatatattgattatcttgca
gcatacggcccgattataacaggtcatgcacacccacacattacagaagcaattaaacgt
gctgcagaaaacggtgtactatatggtactccgactgaacacgaagttgtgtttgcagaa
atgttgcaagaagcaatcccatcattagaaaaagttcgcttcgttaactcaggtacggaa
gctgtgatgacaacgattcgtgttgcgcgtgcatacactggcagagataagatcattaaa
tttgcaggatgctatcacggtcattcagatttagtgcttgtggcagcaggtagtggccct
tcacagcttggtactccagactcagcaggtgtaccaaagagtgtggcacaagaagtaatt
acagtcccatttaatgatatcgaacaattcaaagaagcattctatcacttcggcgatcag
attgcgggtgtattagttgagccaatcgtcggtaacttcggtattgtagaaccccatgca
ggatttctagaagcagtgaacgaagtagcacatagtcacggggcgcttgttatctatgac
gaagttatcactgcattccgtttctgctacggtggtgcacaagatatgcttggtgtaaaa
cctgacttgacagctttcggtaaagttattggtggcggcttaccgattggagcatacggt
ggacgtcaggatatcatggaacatgtcgctcctcttggtccaacttatcaggcaggtaca
atggcaggtaatccattaagtatgcaggcaggtatcgctctacttgaagtaatcaaagct
gaaggcacttatgattatctggataagcttggtgagatgcttgagacaggcatgaatgaa
ctgattgaaaaatacagtatcaaagccaatattaatcgtcttaaaggtgctatgacaatt
tattttacagatgaaaaagtagagaattatgaacaagctgaagcgacggatggagaagct
tttgccaaattctttaaattgatgctacatcaaggaatcaaccttgcaccttctaaatac
gaggcatggttcattacaatcgctcataccgaacaagatattcaagatacactaatcgca
gttgaaaacagtttcaaacaaatgtag

DBGET integrated database retrieval system