KEGG   Macrococcus caseolyticus: MCCL_1664Help
Entry
MCCL_1664         CDS       T00848                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mcl  Macrococcus caseolyticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mcl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1801562..1802413
Genome map
AA seq 283 aa AA seqDB search
MMQPNKHVYMSCEASFDEATTVIYGAPFDGTVSNRPGTRFAADAIRSESYGLETYSPYLN
KDLEDVRIMDSGDVDITIGNKVKVLEELEDTARTILNAGKLPFMIGGEHLVTLGPMRAVL
EKYPDAMLVQLDAHTDLRDDYMGEPLSHATVVRRIHDLIGDNRIYQYGIRSGTKEEFDWS
DTHTVLEKFSIDTLKDLPGIIGNTPVYVTIDLDCLDPSIFPGTGTPEPGGLTYRELEPAF
KVFEQLNVVAADIVELSPPYDHSGVSNAVAAKVARELMLAITK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaccgaataaacatgtatatatgagctgcgaagcttcattcgatgaagcgaca
acagtaatatatggcgcgccatttgacggtactgtttcaaaccgccctggcacacgcttt
gcagccgatgcaattcgttcagaatcatacggccttgaaacatacagcccgtacttaaac
aaagacttagaagatgtgcgcatcatggattcaggcgacgtcgatattacaatcggtaac
aaagtgaaggtattagaagaacttgaagatactgcgcgtacaatcttaaatgcaggcaag
ctgccatttatgatcggtggtgaacatttagtgacgctcggccctatgcgtgccgtcctt
gaaaagtatccggacgcgatgcttgtgcagcttgatgcacatacggacctacgtgatgac
tatatgggggaaccattatctcacgcaacagtcgtacgccgtatacatgaccttattggt
gataacagaatctatcaatacggtattcgttcaggtacgaaagaagagtttgactggagc
gacacacatacggtacttgagaaattctcaatcgatacattaaaggacttacctggtatt
attggtaatacgcctgtatatgtcacaatcgacctggattgcttagatccgtctatcttc
cctggtacaggaacacctgaacccggcggattaacttatagagaacttgaacccgcattt
aaagtattcgaacaactgaacgttgttgcagcagatatcgtagaattgtcaccaccatac
gaccatagtggcgtttctaatgcagttgcagcgaaagttgcgcgtgaactgatgcttgcg
attacgaagtaa

DBGET integrated database retrieval system