KEGG   Macrococcus caseolyticus: MCCL_1852Help
Entry
MCCL_1852         CDS       T00848                                 

Definition
deoxyadenosine kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
mcl  Macrococcus caseolyticus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MCCL_1852
   00240 Pyrimidine metabolism
    MCCL_1852
Enzymes [BR:mcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     MCCL_1852
    2.7.1.76  2'-deoxyadenosine kinase
     MCCL_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1984322..1984978
Genome map
AA seq 218 aa AA seqDB search
MYTIPNDAIITIAGTVGVGKSSLTKALAEKLNFRTSFEKVDNNPYLEKFYNDFDRWSFHL
QIYFLAERFKEQKRMFEYGGGFIQDRSIYEDVDIFAKMHEEGGTMTKEDFATYYQLYEAM
VMTPYFPQPDCLIFLESDYEDVINRIAERGRQMEIETDEAYWRALYARYVEWIENFNACP
VVRININEYDVYGDIDSLDPVIEKIAKVIHTHRAIHKR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaatccctaatgatgcaatcatcactatcgctggtactgtcggagtcggaaaa
agttcgttaacaaaagcactggctgagaagctgaacttcagaacttcttttgaaaaagta
gataacaatccttacttagaaaaattctacaatgattttgatcgctggagctttcattta
caaatctattttcttgcagaacgttttaaagaacaaaaacgcatgtttgaatatggcggc
ggttttattcaggaccgctcaatctatgaagatgtagatatctttgctaagatgcatgaa
gaaggcggcacgatgacgaaagaagacttcgcaacttattatcagttatacgaagcaatg
gtaatgacgccatatttcccgcaacccgactgtttaatcttcttagaaagcgattatgaa
gatgtgatcaatcgtatcgcggaacgtggtcgtcaaatggaaatcgaaacagatgaagct
tattggcgtgcattatacgcacgttacgtcgaatggattgaaaacttcaatgcgtgccct
gtcgtaagaattaatatcaatgaatatgatgtatatggtgatatcgattcacttgatcca
gtgatcgagaagattgctaaagtgatccacacacatcgtgcaatccataaaagataa

DBGET integrated database retrieval system