KEGG   Macrococcus caseolyticus: MCCL_1899Help
Entry
MCCL_1899         CDS       T00848                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mcl  Macrococcus caseolyticus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCCL_1899
Enzymes [BR:mcl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     MCCL_1899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2034015..2034803)
Genome map
AA seq 262 aa AA seqDB search
MKRTQVMGILNVTPDSFSDGGKYNTLQTALSRAQEMIEEGADIIDIGGYSTRPGYTEISI
DEELNRVIPVIESLKDEKIRLSVDTFRSEVAHAALKAGCDIINDQWAGKFDQSMFDIVAQ
HGAEIILMHNAETEVAGDVMEHMITDLCTQARAAEQAGIERDKIWLDPGIGFAKNRNQEI
EVMRRLEELTQIGYKVLLATSRKRMVKELLNDNSVPADRDEGTLATTAIGVNAGVDAVRV
HNVLMNSRFLRVMDQLKGECDG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgaacgcaagtaatgggaattctgaatgtaacgcctgattcattttcggatggt
ggaaaatataacactttacaaactgctttaagtcgtgcgcaagagatgattgaagaaggt
gctgatattatcgatattggaggctattcaacgcgacctggatacacagagatttctatt
gatgaagaattaaatcgggttattccagtgatagaatcgttaaaggatgaaaaaatacgg
ctctctgtagatacttttcgtagcgaagtagcgcatgcagctttaaaggcaggatgcgat
attattaatgaccaatgggctggaaagtttgatcagtctatgttcgatattgtagcgcaa
catggtgcagaaattatattgatgcataatgcagagacggaagttgccggtgatgtgatg
gagcatatgattactgatttatgtacacaagcaagagcagcagaacaagctggtattgaa
agagataaaatttggcttgatccaggtattggttttgcaaagaaccgtaatcaagaaatt
gaggtcatgagaaggcttgaggaacttacgcaaataggatataaagtattgttagctact
agtcgtaaacgcatggtgaaagaattgctgaacgacaactcagtacctgcagatcgtgat
gaaggcacacttgcaacaacagcaattggtgtgaatgcaggtgtagatgcggtgcgagtg
cacaatgttttgatgaatagtaggtttttacgtgtaatggatcaactaaaaggagaatgt
gatggatag

DBGET integrated database retrieval system