KEGG   Macrococcus caseolyticus: MCCL_1933Help
Entry
MCCL_1933         CDS       T00848                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mcl  Macrococcus caseolyticus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mcl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2073031..2073627)
Genome map
AA seq 198 aa AA seqDB search
MHYPAPISKLIDSFMKLPGIGPKTASRLAFHVLDMKEDDVVGFAKALVDVKRELTYCSVC
GHITDTDPCYICEDKTRDQSMICVVEETKDVIAMEKMREYKGLYHVLHGAISPMEGVGPE
DINVPSLLTRLRDEHIQELILATNPNIEGESTAMYIARLVKPIGIKVTRLAHGLPVGGDL
EYADEVTLSKAITGRTEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattatcctgcaccaatttctaaattaattgatagttttatgaaactgcccggaatc
ggcccgaaaacagcaagtcgcttagcatttcatgtattagatatgaaagaagacgatgta
gtaggttttgcgaaggcacttgtagatgtgaagcgtgaattaacgtattgttcagtctgc
ggacatattacggatacagatccatgttatatatgtgaagacaagacgcgtgaccaatct
atgatatgtgtagtagaagaaactaaagacgttatcgccatggagaagatgcgagagtat
aaagggctgtatcatgttctgcacggtgcgatttctccgatggaaggcgttggacctgaa
gatattaatgtcccttcattgctcacgagattacgtgatgagcatatacaggaattaata
ttagcaacgaatccaaatattgaaggtgaatcaacggcaatgtatattgcaagactcgtg
aaaccgattggaattaaagtgacacgtctagcgcacggtttacctgtaggtggagattta
gagtatgcagatgaagtgacgttatccaaagcaataacaggaagaacggaaatctag

DBGET integrated database retrieval system