KEGG   Macrococcus caseolyticus: MCCL_plsB0051Help
Entry
MCCL_plsB0051     CDS       T00848                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mcl  Macrococcus caseolyticus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCCL_plsB0051
   00670 One carbon pool by folate
    MCCL_plsB0051
Enzymes [BR:mcl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MCCL_plsB0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMCCL2:58359..58853
Genome map
AA seq 164 aa AA seqDB search
MIISLIAAISSNYVIGKDKDIPWKIPGEQVRFKDLTMGKSVIMGRKTFESIGQPLPNRKT
IIISKSKDINYNNCLTVESLERAFNLLQQEDEIFIAGGGEIYKESLPFADRIYLTIIEKE
YEGNIFFPMFNKDEFEITYQQKVEGFIPYTYFTYERKNKGEQIK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatcatttcattaattgctgcaatttcaagtaattacgtaatcggcaaagataaggat
ataccatggaagattcctggtgaacaggttcgatttaaggatttaactatgggtaaatca
gtaattatgggtagaaagacatttgaatctattggtcagccactgccgaacagaaagaca
attattatctcaaaatctaaagatattaattataataattgcctgactgtagaatcgtta
gagagggcttttaatttactacaacaagaagatgaaatttttattgcaggtggtggagaa
atatataaggaatcgttaccatttgccgatagaatatatttaactattatcgaaaaggaa
tatgaaggtaatatcttttttccaatgtttaataaagatgagtttgaaatcacctatcaa
caaaaagtagaagggtttataccctatacatattttacatacgaaagaaaaaataaagga
gagcaaatcaaatga

DBGET integrated database retrieval system