KEGG   Metallosphaera cuprina: Mcup_0094Help
Entry
Mcup_0094         CDS       T01467                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mcn  Metallosphaera cuprina
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mcn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82932..83720
Genome map
AA seq 262 aa AA seqDB search
MDITSSFRPGSRFAPQKIRQVSQFIEYLSIRSGIDMSNVGFVDYGDIVLHPSDVAENIER
ITQVTSYLSDLKKIVVSIGGEHTVTVGTVLGTKADCVLSFDAHLDLRDEYMGYKYDHACV
QRRLSEKGVMIIEIGNRAMGSDEIEYARSNKIPFFTSHEVKLLGPQEVAKKVINFLSPCK
RVYITYDMDVLDPSYAPGVATPEPEGLDVSTVLDIMNLVVDDRVVGFDVVEVSPPYDPSE
ITSVVAAKLILETSAKIKTRLP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggatataacaagtagttttagaccaggaagtagattcgctccacaaaaaataaggcaa
gtatcacagtttattgaatatctttccataagatccgggattgatatgtcgaatgttggt
ttcgtagattatggtgatatagtactccacccttcagatgtcgcagagaatattgaaagg
ataacccaggtgactagttacttatctgatctgaagaagatagttgtatcgataggaggt
gagcatacggtaactgttggtacagtcttaggaactaaggcagattgcgttctaagcttc
gatgctcaccttgatctgcgcgatgaatacatggggtataagtacgatcatgcatgcgtt
caaaggagattgagcgagaagggtgttatgattattgagataggaaacagagctatggga
tcggatgagatcgaatatgctagatctaacaaaattccgttcttcacatcacatgaagtc
aaattgctgggacctcaagaggtagcaaagaaggtaataaatttccttagtccctgtaaa
agagtatatataacatatgacatggacgtcctagatccgtcatatgctcctggagttgcg
actccagaacctgaggggctcgacgtatctaccgtgttagatataatgaacttggttgta
gacgatagagtagtaggtttcgatgtagttgaggtttcaccaccatacgacccatctgag
ataacgtcagtagttgctgcaaagctcatccttgagacttccgcaaaaataaaaactaga
ttgccttaa

DBGET integrated database retrieval system