KEGG   Metallosphaera cuprina: Mcup_0201Help
Entry
Mcup_0201         CDS       T01467                                 

Definition
protoporphyrin IX magnesium-chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mcn  Metallosphaera cuprina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mcup_0201
Enzymes [BR:mcn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mcup_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
178773..180596
Genome map
AA seq 607 aa AA seqDB search
MRRTFPFSAIVGQEKLKRALLIVAVDSTIAGVLIKGPKGVAKSTAVRALANLLPEIEVVA
DCPFSCDPDNKEKMCSSCRSRIESGEKLPRLKRKKKIVDLPVSATLDRVVGTLDIKKILK
EGERGLEPGLLAQANRGILYIDEVNLLPDDVVNAILDAASSKYNVVEREGVSIVHPADFI
LIGTMNPEEGELRPQLLDRFAISVEAEAPKTPEELIEISNRVEEFERTQEKFLKAYEEEE
EKLKKKIYDATLILPRVTISEAHLKYIADTILTFSASTRAMIYAVKVAKALASLDGRVEV
NERDVKDALELVLSHRVPNFDRSSLPNVSKNERSDTSESPTFQGNTQWKEELSNRVSKER
DETEPNHSEISIPKSKVKGTGFGKGGLFDSILGKYRGEGLHLDLYASLINMALHKRSWLE
PQDLSIKGVESTGALPILLLLDSSKSMEFSKRISLAKSILKGLLIKAYQIRSKVGLVTFS
GFSSEYVVPITKNFKKVESSIEAVRPSGKTPISSALALAIQIINRETRSRRGVLPIVFLI
SDGKANVGLRNNIANELSELSSKLGKISKVIVIDTSMPHQPSFNNLISSKANGILIRANN
FITDLHI
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggacattcccgtttagtgcgatagttggccaggagaagttgaagagagcctta
ttgatagtggcagtggactctacgatagcaggggttctgataaaaggacctaaaggcgta
gctaagtcaactgctgttagagctttagcaaacctgttacctgaaatagaggttgtagca
gattgtccgttctcgtgcgatccggataataaggagaagatgtgttcttcgtgtagatct
cgcatcgaatccggtgagaagctccctagactaaagagaaaaaagaagatcgttgaccta
ccagtaagtgcaacactggacagagtggttggaacgttagacataaagaaaatcctgaag
gaaggagaaaggggcctagaacctggactgttagctcaggcaaacagaggcatattgtat
atcgatgaagttaaccttctcccggacgacgtagttaacgctattttggacgcggcctca
tctaagtataatgtagtagagagagaaggggtgtctatagtgcatccggccgacttcata
ttaatcggcacaatgaatccagaagagggcgagctcagacctcaactgttagataggttc
gcgatatccgtagaggctgaggcgccaaaaacccctgaggaattgatagaaatatcaaat
agagtagaagagttcgagagaactcaagagaagttccttaaggcttacgaagaggaggaa
gagaagttaaagaagaaaatttatgacgcaactctaattcttccgagagtaaccatttct
gaagcgcatttaaaatatattgcagatacaatactaactttctccgctagtacaagggct
atgatatatgcggtgaaagtagccaaggccttagcctcactagatgggagagtagaggta
aatgaaagagacgttaaggacgcgcttgagcttgtgttaagtcatagagtgccgaacttt
gataggtctagtttgcctaatgtgagtaagaatgaaagatcagatactagtgagagccca
actttccagggcaacactcaatggaaagaagaattatcgaacagggtttctaaggagcga
gatgaaaccgaacccaatcacagtgagataagtattccaaaaagtaaggtaaagggaaca
ggattcgggaagggaggcctatttgattcaatactgggaaaatatcggggagaaggctta
catctagatttgtacgcatctttaattaacatggccctccataaaagatcatggttagag
ccgcaggatctatcaataaagggcgtggagagcactggagccttacctatactattactc
ttggattccagcaagtctatggaattctctaagagaattagcttagctaagtccatcctt
aaaggtcttctgataaaagcctatcaaataagaagtaaagtgggtttagtaactttttct
gggttctcctccgagtatgtggttccaataacaaagaactttaaaaaagtagagagctca
atagaggctgtaaggccgagtggcaagactccaatttctagcgcgctcgctttagccatt
caaataatcaatagggagacgagatccaggagaggagtattaccaatagttttcctaatc
tcagacggtaaggcgaacgtaggattacgtaacaatatagctaatgagctttcagaatta
tcgtctaagctagggaagatatccaaggtcatagttatagacactagtatgcctcatcag
ccttcgttcaataatctaattagtagtaaagctaatggtattcttataagagctaataat
tttataactgatttgcacatttga

DBGET integrated database retrieval system