KEGG   Metallosphaera cuprina: Mcup_0320Help
Entry
Mcup_0320         CDS       T01467                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mcn  Metallosphaera cuprina
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mcup_0320
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mcup_0320
Enzymes [BR:mcn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mcup_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283430..284326
Genome map
AA seq 298 aa AA seqDB search
MKDVISVLDFTKTEILQIFELTDKLLTGQFKPNLKGKIIANAFFEPSTRTALSFASAALS
SGGKVLGFASDESTSISKGENLADTIRMLDNYADCIVMRHKLDGSAKFASEIASKPVVNA
GDGKREHPTQALIDIYTVRSLFHSVEGLTFGFLGDLRYARTVNSMLRILTLFNPKMVYLI
SPPQLRARLEILNELNYPFKELSDVRDVINEVDVLYVTRIQRERFLDEDEYEKVKESYRV
DLKMIEGMKREAAILHPLPRVSEIDRRIDSTPQAKYFLEASYAVPLRSVLLNEVVSGD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggatgtaatttctgtgctcgatttcactaaaacggaaatcttacaaatctttgag
ctaaccgataaattgttaacaggacagttcaaaccaaacttaaaaggaaagattatagct
aacgccttctttgagccgagcactaggactgcgttaagtttcgctagcgcggccttatcc
tctggcggtaaagttttaggattcgcctcggatgaatctacgtcaatatcaaagggcgaa
aatcttgcagataccattaggatgcttgataactacgcagactgtatcgtaatgagacac
aagctagacggatccgcaaaattcgcatcagagatagcgagtaaaccggttgtgaacgcc
ggtgatggaaaaagagaacatccgacgcaggctctaatagacatctacacggtaagaagt
ctgtttcatagcgtagaaggactaactttcggattcttaggagatctaagatatgctagg
acagtcaatagtatgcttaggattctcacactttttaaccctaagatggtttaccttatc
tcgcctcctcagcttagggctaggttggagatcttaaacgagttgaattatccgtttaaa
gagctctctgacgtcagggacgtgatcaatgaagtagatgtgctttacgtaactagaata
caaagggagagatttctcgatgaagacgagtatgaaaaagttaaggaaagttacagggtg
gacctaaagatgattgagggaatgaaaagagaggccgccatacttcatcccttaccaagg
gtgtcagaaatagatagaagaatagatagcactcctcaagccaagtacttcttggaggca
tcctacgctgttcctcttagatcggttctcctaaatgaggtcgtcagtggtgattga

DBGET integrated database retrieval system