KEGG   Metallosphaera cuprina: Mcup_0529Help
Entry
Mcup_0529         CDS       T01467                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00260  Glycine, serine and threonine metabolism
mcn00750  Vitamin B6 metabolism
mcn01100  Metabolic pathways
mcn01110  Biosynthesis of secondary metabolites
mcn01120  Microbial metabolism in diverse environments
mcn01230  Biosynthesis of amino acids
Module
mcn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mcup_0529
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mcup_0529
Enzymes [BR:mcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mcup_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AEB94636
UniProt: F4G0L7
Position
complement(482376..483482)
Genome map
AA seq 368 aa AA seqDB search
MEISVKLPPSFSFSKLKGRGVWRYSEAIAGNYRKVITINEGGTPLIKGKVGEVYYKFEGA
NPTGSFKDRGMTVAISSAVNEGYKIVIAASTGNTAASAAAYSARAGLRIYLVLPKDKVAI
GKIAQAVLYGATILEVEGSFDVGMKAVMKLYKDMGIVYPLNSFNPWRLEGQKTIAYEIAE
EIRVPDFVFVPVGNAGNIYAIWKGFTELRDAGIIDKIPRMIGVQAEGASPIAKAIVNNLD
TPQFVENPETIATAIRIGKPVNWRKAMKAIKESQGTAVYVSDSEIVEAQKELARTEGIGA
EPASVASFAGYKKAIQEGLVDKSSEVVIVLTGHALKDPDSMIKSSARRILVNPDHLENVI
LGDLNAGN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
ttggaaatatcggttaagttacctccctccttctcgttttccaaactaaaggggagaggt
gtttggagatattccgaggcgatagctggaaactataggaaagtgataaccataaacgaa
ggcggaacgcccctcatcaaggggaaagttggagaggtttactataagtttgagggtgct
aatccaactggaagcttcaaagatagaggaatgacagtagcgataagctcagcagtgaac
gaaggttacaagatcgtaatagctgcctctactggaaacacggctgcgtctgccgcagcg
tactccgctagggccggccttagaatatatttagttctccctaaggataaggtagccata
gggaagatagcacaggctgtcctttatggcgccacgatcttagaggttgaaggaagtttc
gacgttggaatgaaggcagtaatgaagctatacaaggacatgggtatagtttacccattg
aactctttcaatccgtggagattggagggacagaaaaccattgcctatgaaattgctgag
gagatcagggttcctgatttcgttttcgtaccggttggtaacgcaggcaatatatacgcg
atctggaaaggtttcacagaactaagggacgctggcataattgataaaatacctaggatg
ataggggtacaggctgaaggcgcttcccccatagctaaggccatagttaataacttagat
actcctcaatttgtagagaatcctgagaccatagctacagctatcaggatagggaagccg
gtaaactggaggaaggccatgaaagcgataaaggagtctcagggaactgcagtttacgta
agcgacagtgagatagtggaggcccaaaaagagttagctagaactgaaggcataggtgct
gaacctgcctctgtggcctctttcgctggatataagaaagctatacaggagggtctagta
gataagtcaagtgaggttgtaatagttttaactggtcatgctctaaaggacccggactca
atgattaaatcctcggctaggaggatattggttaacccagatcatttggagaacgtaatt
ctgggtgatctaaatgccggtaattaa

DBGET integrated database retrieval system