KEGG   Metallosphaera cuprina: Mcup_0537Help
Entry
Mcup_0537         CDS       T01467                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mcn  Metallosphaera cuprina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mcup_0537
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mcup_0537
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mcup_0537
Enzymes [BR:mcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mcup_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
490769..492034
Genome map
AA seq 421 aa AA seqDB search
MANNEEIIPSYWYNIIPDLPKPLPPPRDPPDAEFSRIDLLRKIMPSEVLRQQFTVERFVS
IPREVREAYINIGRPTPLMRARRLEEFLNTPARIYFKYEGATPTGSHKINTALPQAYFSM
REGIDHVVTETGAGQWGTAVALSAKMYGISSTVFMVKVSYEQKPQRRTIMQLYGANVFSS
PTSYTEYGKKVLNENPKHPGSLGVAMSEAIEYAMSNGYKYLVGSVLDVVVLHQSVIGLEA
IRQLQELDEEPDTLVGCVGGGSNFGGFSFPFIGSRKGSKFIAVGSYEIPKFSQGSYNYDF
PDSAGLLPLVKMITLGRDYVPPPIYSGGLRYHGAAPSLSMLIKEGIVDWREFNEREIFEA
AQIFLQTQGIVPAPESSHAIKAVIDEAREAKKKNEKKVIVFNLSGHGLLDLPNYESMMRR
M
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataatgaggaaataataccaagttattggtataatatcataccagatttacct
aagcccttacccccgccaagagatcctcctgatgcagaattctccaggatagaccttcta
aggaaaataatgcctagcgaggtattaaggcaacagttcactgtcgagaggttcgtctct
ataccgagggaggttagggaagcttacattaacataggaagaccaaccccactcatgagg
gcaaggagattagaggagttcctcaacactcccgctaggatatactttaagtatgagggg
gctactcctacaggctcgcacaaaataaacacggcgttaccccaggcatacttctcaatg
agggagggaatagatcacgttgttactgaaaccggggctggtcagtggggaaccgcggta
gctctctcagctaagatgtatggaataagctccacggtcttcatggtgaaagttagttat
gaacagaaacctcagcggaggacaatcatgcagttatatggagctaacgtattctccagt
ccaacctcttatacagaatatggtaaaaaagtgttaaatgagaatcctaaacatccaggt
tctttgggagtagctatgagcgaggcgattgagtatgcgatgtctaacggttacaagtat
ttggtaggcagcgtcttagatgtggtggttctgcatcaaagcgttattggattggaggca
ataaggcaactacaagaactggacgaagagccggatacacttgttggttgcgtaggtgga
gggagcaactttggtggcttttcgttcccgttcataggatcaaggaaaggttctaagttt
attgcagtaggctcttatgagatacccaagttcagtcaaggatcctataactatgacttc
ccagacagcgcaggcttactaccactagtcaagatgattaccttaggcagagattacgta
cctccgcctatttattcaggagggctgagatatcacggggcagctccttcacttagcatg
ttaattaaggagggcatagtggattggagggagttcaacgaaagagagatatttgaagcg
gctcagatatttcttcagacacagggaatagtacctgccccggagtcctctcacgctata
aaagctgtaatagatgaggcaagggaagctaagaaaaagaacgagaaaaaggttatagtg
tttaatctaagcggtcacggtctacttgatctgcccaattacgagtctatgatgaggagg
atgtag

DBGET integrated database retrieval system