KEGG   Metallosphaera cuprina: Mcup_0538Help
Entry
Mcup_0538         CDS       T01467                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mcn  Metallosphaera cuprina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mcup_0538
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mcup_0538
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mcup_0538
Enzymes [BR:mcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mcup_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
492035..492766
Genome map
AA seq 243 aa AA seqDB search
MKMLVSYSTLGYPDKDNYLKFVKGLVDSGSDILEIGLLPKYAKYDGPVIRRSYKEVSKWL
KDVWSLLEETRRAVDVPLVILTYLEDWASSLPELLDRMKDIGIDGVLFPDLLIDYVDEYE
RYVKEIKSHGIKAVIFTSPSVPDPLIHKVSTLSDIFLYFGVRPTTGVPLPVGVDSLITRV
RTLVKNKLVVGFGLSDVNDMVKALKAGADGVAIGTVYIEEIERNGVNSAISLAKKFRAIL
DGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgctagtgtcttactccacgttgggctatccagataaggataattatctaaag
tttgttaaagggttagtagattccggttctgatatcctcgaaataggcctgttacctaag
tatgcgaaatacgacgggcccgtaataaggagaagttataaggaagtgtcaaagtggctt
aaggacgtatggagccttctagaggagactaggagagccgtagacgttcctttggtcatt
ctcacataccttgaggactgggcgtcttcgcttccagaactcctagataggatgaaggat
ataggaatagacggagtgctcttccctgaccttttaatagattacgttgatgagtacgag
agatatgtgaaggaaattaagagtcacgggataaaggcagtgatatttacctcaccttcc
gttcctgatcccctcattcataaagtgtctactctctcagacatctttctgtacttcgga
gtcagaccaactaccggagttcctttaccagttggtgttgactccctaataactagagtt
agaaccttagttaagaacaaactggtagtgggcttcgggctttctgacgtaaacgatatg
gttaaggcattaaaagccggagctgatggagtagccataggtaccgtttacatagaggag
atagagaggaacggggtgaattcagctatttcgttggcaaagaagtttagggcgatattg
gatggagcctaa

DBGET integrated database retrieval system