KEGG   Metallosphaera cuprina: Mcup_0817Help
Entry
Mcup_0817         CDS       T01467                                 

Definition
Alpha-amylase
Orthology
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
mcn  Metallosphaera cuprina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mcup_0817
Enzymes [BR:mcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mcup_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731566..732900
Genome map
AA seq 444 aa AA seqDB search
MTNKIVLGFEVHQPFRIRKDAFWNPRFRGSIEEKYFDNELNRQIFERVKAKCYIPATSIV
MEEIEAGEDEGREVKFFYSVSGTLLEQAERWGKDFLDLLQLLSSTKKVEFLAQTYYHSVT
SLWEDKTEWREQVKSHLEALKSLLGQNPVTFENTELLTDPSIVQEAEELGFKGLIMEGKE
SVLNGKSPNFVFRRKDGNISILPRNYVLSDDIAFRFSNTKWDQYPLTAQKYSEWIRSTPG
QLVTVFVDYETFGEHNWKESGILEFLRWLPRELNKVGVTMSLPREVINSPYYDLEIEGIS
SWADVRKDHSSWLGNIMQWAYDEAVRRAEMPSRELGGDYLKAWKRFTTSDNYYYLFTEGG
GPGEVHSYFNAYNSPIDGFLNEFYAVNAFLHEELSKLGINNEPFFFYKGGKKVGIAWNES
EFMEVLKRDESLKENVKYLREWLK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaagatagtgttaggctttgaagttcatcagccgttcagaattaggaaggac
gctttttggaacccaagatttagaggttcgattgaggagaagtactttgataacgaatta
aacaggcaaatatttgaaagagttaaggctaagtgttacataccagccactagcatagta
atggaggagattgaggcgggagaagacgagggaagggaagttaagttcttctactctgtg
tccgggacgttgttggaacaagctgaaagatggggaaaagacttcctagaccttcttcag
ttactttcatcaacgaaaaaggtggagtttctagctcagacctactatcactcagtcacc
tccttatgggaggataagacggaatggagagagcaagttaagtcccatttggaggctttg
aagtctctccttggtcaaaaccctgttacttttgagaacacagagctgctgactgacccc
tcaatagttcaagaggctgaggaattgggtttcaagggtctaatcatggagggaaaggag
agcgtccttaatggaaagtcacccaactttgtgttcaggagaaaagatgggaacatatca
atccttccaaggaactacgtgttaagcgacgatattgctttcaggttctccaacaccaaa
tgggatcaatatccattaacagcacagaagtactctgagtggattagatcaacaccaggt
caactcgttactgtgttcgtggattatgagacttttggagagcacaattggaaggagagc
ggtatcttagaatttctaagatggttacctagggaactgaacaaggttggggtcacgatg
agtcttccaagggaggtgataaacagtccatattatgacctggaaatagagggcatatcg
tcctgggctgacgttaggaaggatcactctagttggttaggcaacataatgcagtgggcc
tatgacgaagctgtgaggagggcggagatgccatcaagggagttaggtggggattacctt
aaagcgtggaaacgcttcaccacaagtgacaactattattaccttttcacggaaggcggt
gggcccggtgaggtgcactcttactttaacgcatacaactcacccattgatggtttccta
aacgagttctacgccgttaacgcattcctccatgaggaattgagcaagttagggattaac
aacgaacccttcttcttctataagggaggaaagaaggtaggcatagcatggaacgagtcc
gaattcatggaggtcttgaaaagagacgaatcgcttaaagagaacgttaagtatttgaga
gagtggttaaagtga

DBGET integrated database retrieval system