KEGG   Metallosphaera cuprina: Mcup_0835Help
Entry
Mcup_0835         CDS       T01467                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00260  Glycine, serine and threonine metabolism
mcn00750  Vitamin B6 metabolism
mcn01100  Metabolic pathways
mcn01110  Biosynthesis of secondary metabolites
mcn01120  Microbial metabolism in diverse environments
mcn01230  Biosynthesis of amino acids
Module
mcn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mcup_0835
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mcup_0835
Enzymes [BR:mcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mcup_0835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-ProteinID: AEB94940
UniProt: F4G292
Position
complement(744368..745372)
Genome map
AA seq 334 aa AA seqDB search
MKALCMKCGREREGMEIRCKCGGAFKIDVDIPFYKNVRDNFPYVKKWVSLGEWNTPLIRI
EKFWYKLDLLNPTGSYKDRGSVTLISRLYQEGVKEISEDSSGNAGASIAAYGALAGMKVK
IFVPSTARGGKLKQIQSYGAEVVKVEGSREEVAISAERSGAYYASHVLQPEFRDGIRSLA
YEIVMNRQGKPPSQVFLPTSAGTLLLGVYEGFNHMLREGIIDEMPKIIAVQTEEVSPVCS
KLKGKVYNPPVKFSSIADALVSTNPVLLDEMVNVLKETGDCVIVNEREIIDSWNYLRGKG
LLVEYSSAVGLAGARKLGDEESVIVITGNGLKVL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttatgtatgaagtgtggaagggaaagagaagggatggaaataaggtgtaag
tgtgggggagcctttaagatagacgtggatatcccgttttacaaaaacgttagagataac
tttccgtacgtaaaaaagtgggtaagcttaggagagtggaacacgcctttgataaggata
gagaagttttggtataagcttgatcttcttaacccgacaggttcttataaggatagaggc
tctgttacattaatatcacgactctatcaagagggagttaaggagatatccgaggactcc
tcaggcaacgcaggagcctcgattgcggcatacggagcgctagcaggaatgaaagtaaag
atattcgtaccttcgacagccagaggagggaagttaaagcaaatacaatcctacggagct
gaggtagtgaaggttgaaggtagtagagaggaagttgccatatcagcagaaagatctgga
gcttactacgcctctcacgtgctacaacccgaatttagagacggaataagatccttggcc
tacgaaattgtaatgaatagacaagggaaacctccgtcacaggttttcctacctacatcg
gctggaactcttctcctaggagtttatgaagggtttaatcacatgctcagagaagggata
atagacgaaatgcctaagattattgcagtgcaaacggaagaggtatctccagtatgttcg
aagttgaaaggaaaggtatacaatccgccagtaaaattttcctccatcgccgacgctcta
gtttctaccaacccagtgctactagacgagatggtaaatgtgctcaaagagactggagat
tgcgtaatagtaaacgagagggaaatcattgattcctggaattaccttagagggaaagga
ttattagtcgagtacagctccgcagtaggtttagcgggagcaaggaaattaggagatgag
gagtcggtaatagttattacgggcaacggactcaaagtactataa

DBGET integrated database retrieval system