KEGG   Metallosphaera cuprina: Mcup_0880Help
Entry
Mcup_0880         CDS       T01467                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mcn  Metallosphaera cuprina
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mcup_0880
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mcup_0880
   00620 Pyruvate metabolism
    Mcup_0880
   00640 Propanoate metabolism
    Mcup_0880
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mcup_0880
   00680 Methane metabolism
    Mcup_0880
Enzymes [BR:mcn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mcup_0880
Lipid biosynthesis proteins [BR:mcn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mcup_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(791378..793366)
Genome map
AA seq 662 aa AA seqDB search
MSNQESELNLPVKEKIVPESLKTKTIDPKDYLTFHKLTLDNNLEFWESIAKELEWFKPWE
RTLDSSNPPFYKWFVGGELNASYLAVDRHFRSWRRNKVALIWEGEPWDSSPREVRKLTYL
DLFREVNKTAYLLKSYGLKRGDKIGIYLPMIPELPIFMLAAARLGLIFSVVFSGFSAQAL
ADRMNDAGAKLLITADGGWRRGKVVQLKEIVDKALEMNKSIKDVIVVRRTGSEVRMEKGR
DSFLHDLMSQVPNNAYVEPERVKSEDPLYILYTSGTTGKPKGIVHDTGGYMTLLHLTMRQ
VFDLRDEDVYWCTADVGWVTGHSYIVFGPLLEGATEVMYEGALDYPEPDRWVSIIERHQV
SILYTSPTAIRTFMRQGERWITKHDVSSIRLIHSVGEPINPEAWRWFFKLVGREQVPFGS
TWWMTETGGIMISHTPGGYLVPMKPGTNALPLPGIGAEVVNEEGKVKSGEKGYLVLTKPW
PGMPLTIYGDPDRYVKVYWEKFPGAFYAGDYAIKDQDGYFWILGRADEVLKIAGHRIGTY
ELESALIQHPSIAEAAVVGVPDQVRGEVAEAFVILRSGVEPNQGLKDEINRFVRDNFGPI
AVFKDIHFVSKLPKTRSGKIMRRVIRAVASNSPIGDVTTLEDEASVDEIRNAYKEFMREV
KK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatcaggaaagtgaacttaaccttccggttaaagagaaaatagttcctgaatcc
ctaaagacgaaaactatagatcctaaggattacttgacttttcacaagttaacgttagac
aacaaccttgagttctgggagtcgatagctaaggaattggaatggttcaagccctgggaa
aggacgttggacagttcgaaccctcctttctacaaatggttcgttggtggtgagctcaac
gcgtcctaccttgcggtagacagacactttagatcctggaggaggaacaaagtagcccta
atatgggaaggagagccatgggattctagccctagggaagttaggaagctgacttacttg
gatctatttagggaagtgaacaagactgcgtacctgctcaagagctacggactaaagagg
ggagataagatagggatataccttcctatgataccagagttacctatctttatgctagcg
gctgcgaggttaggtctgatcttctcagttgtattctcggggttcagcgctcaggctctc
gcggatagaatgaacgatgctggagctaagcttctgataactgcagacggagggtggaga
agaggtaaggtggttcaactcaaggagatagttgacaaggctctggagatgaacaagtcc
ataaaggacgttatagtggtgaggaggaccggctctgaagtgaggatggagaagggtagg
gactctttccttcacgatcttatgtcccaggttccaaataacgcctacgtagagccagag
agggttaaaagcgaggacccgctctacattctttacacctcagggactacgggaaagcca
aaggggatagtacacgacactggaggttacatgacgttacttcacctcacaatgaggcaa
gtcttcgacctaagggatgaggacgtttactggtgcacggcagatgtgggctgggtcacc
ggacattcctacatagtgttcggacctttacttgagggggcaactgaggtaatgtatgag
ggggcgttagactatccagagccggacagatgggtctcaataatagagaggcatcaggtt
tcgatactttacacttcccctacagcaataaggacgttcatgaggcaaggtgagagatgg
attacgaagcacgacgtgagcagcataaggttgatacactctgttggggaaccaataaat
ccggaggcgtggaggtggttctttaaactggtcggaagggagcaggtgcctttcggaagc
acttggtggatgaccgagaccggtgggataatgatatcccacacccctggaggctaccta
gtcccgatgaagcctgggaccaacgccctgcccttacctgggataggagctgaggttgta
aacgaagagggtaaggtgaagtctggagagaagggttaccttgttttgaccaaaccttgg
cccggaatgcctctgaccatatacggagaccctgacagatacgttaaggtttactgggag
aagttccctggcgcgttctacgctggagactacgccataaaggatcaagacggatacttc
tggatcttagggagggcggatgaggtactcaagatagctggccataggattggaacttac
gaacttgagtcagccctgatccaacacccgtcaatagcggaggccgctgtggttggtgtt
cctgaccaggttagaggagaggtggccgaggccttcgtgatactgagatcgggagtagag
cccaatcaagggttgaaggatgagataaacaggtttgtcagggataacttcggtcccata
gcagtattcaaggacatccacttcgtctccaagttacctaaaaccaggagcggtaagata
atgaggagagttataagggcggtagctagcaattcgcccataggcgacgttacaacgctt
gaggacgaggcctcagtagatgagataaggaacgcgtacaaggaattcatgagggaggtc
aagaagtga

DBGET integrated database retrieval system