KEGG   Metallosphaera cuprina: Mcup_0880Help
Entry
Mcup_0880         CDS       T01467                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00010  Glycolysis / Gluconeogenesis
mcn00620  Pyruvate metabolism
mcn00640  Propanoate metabolism
mcn00680  Methane metabolism
mcn00720  Carbon fixation pathways in prokaryotes
mcn01100  Metabolic pathways
mcn01110  Biosynthesis of secondary metabolites
mcn01120  Microbial metabolism in diverse environments
mcn01130  Biosynthesis of antibiotics
mcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mcup_0880
   00620 Pyruvate metabolism
    Mcup_0880
   00640 Propanoate metabolism
    Mcup_0880
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mcup_0880
   00680 Methane metabolism
    Mcup_0880
Enzymes [BR:mcn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mcup_0880
Lipid biosynthesis proteins [BR:mcn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mcup_0880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N PRORP
Motif
Other DBs
NCBI-ProteinID: AEB94985
UniProt: F4G2D7
Position
complement(791378..793366)
Genome map
AA seq 662 aa AA seqDB search
MSNQESELNLPVKEKIVPESLKTKTIDPKDYLTFHKLTLDNNLEFWESIAKELEWFKPWE
RTLDSSNPPFYKWFVGGELNASYLAVDRHFRSWRRNKVALIWEGEPWDSSPREVRKLTYL
DLFREVNKTAYLLKSYGLKRGDKIGIYLPMIPELPIFMLAAARLGLIFSVVFSGFSAQAL
ADRMNDAGAKLLITADGGWRRGKVVQLKEIVDKALEMNKSIKDVIVVRRTGSEVRMEKGR
DSFLHDLMSQVPNNAYVEPERVKSEDPLYILYTSGTTGKPKGIVHDTGGYMTLLHLTMRQ
VFDLRDEDVYWCTADVGWVTGHSYIVFGPLLEGATEVMYEGALDYPEPDRWVSIIERHQV
SILYTSPTAIRTFMRQGERWITKHDVSSIRLIHSVGEPINPEAWRWFFKLVGREQVPFGS
TWWMTETGGIMISHTPGGYLVPMKPGTNALPLPGIGAEVVNEEGKVKSGEKGYLVLTKPW
PGMPLTIYGDPDRYVKVYWEKFPGAFYAGDYAIKDQDGYFWILGRADEVLKIAGHRIGTY
ELESALIQHPSIAEAAVVGVPDQVRGEVAEAFVILRSGVEPNQGLKDEINRFVRDNFGPI
AVFKDIHFVSKLPKTRSGKIMRRVIRAVASNSPIGDVTTLEDEASVDEIRNAYKEFMREV
KK
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatcaggaaagtgaacttaaccttccggttaaagagaaaatagttcctgaatcc
ctaaagacgaaaactatagatcctaaggattacttgacttttcacaagttaacgttagac
aacaaccttgagttctgggagtcgatagctaaggaattggaatggttcaagccctgggaa
aggacgttggacagttcgaaccctcctttctacaaatggttcgttggtggtgagctcaac
gcgtcctaccttgcggtagacagacactttagatcctggaggaggaacaaagtagcccta
atatgggaaggagagccatgggattctagccctagggaagttaggaagctgacttacttg
gatctatttagggaagtgaacaagactgcgtacctgctcaagagctacggactaaagagg
ggagataagatagggatataccttcctatgataccagagttacctatctttatgctagcg
gctgcgaggttaggtctgatcttctcagttgtattctcggggttcagcgctcaggctctc
gcggatagaatgaacgatgctggagctaagcttctgataactgcagacggagggtggaga
agaggtaaggtggttcaactcaaggagatagttgacaaggctctggagatgaacaagtcc
ataaaggacgttatagtggtgaggaggaccggctctgaagtgaggatggagaagggtagg
gactctttccttcacgatcttatgtcccaggttccaaataacgcctacgtagagccagag
agggttaaaagcgaggacccgctctacattctttacacctcagggactacgggaaagcca
aaggggatagtacacgacactggaggttacatgacgttacttcacctcacaatgaggcaa
gtcttcgacctaagggatgaggacgtttactggtgcacggcagatgtgggctgggtcacc
ggacattcctacatagtgttcggacctttacttgagggggcaactgaggtaatgtatgag
ggggcgttagactatccagagccggacagatgggtctcaataatagagaggcatcaggtt
tcgatactttacacttcccctacagcaataaggacgttcatgaggcaaggtgagagatgg
attacgaagcacgacgtgagcagcataaggttgatacactctgttggggaaccaataaat
ccggaggcgtggaggtggttctttaaactggtcggaagggagcaggtgcctttcggaagc
acttggtggatgaccgagaccggtgggataatgatatcccacacccctggaggctaccta
gtcccgatgaagcctgggaccaacgccctgcccttacctgggataggagctgaggttgta
aacgaagagggtaaggtgaagtctggagagaagggttaccttgttttgaccaaaccttgg
cccggaatgcctctgaccatatacggagaccctgacagatacgttaaggtttactgggag
aagttccctggcgcgttctacgctggagactacgccataaaggatcaagacggatacttc
tggatcttagggagggcggatgaggtactcaagatagctggccataggattggaacttac
gaacttgagtcagccctgatccaacacccgtcaatagcggaggccgctgtggttggtgtt
cctgaccaggttagaggagaggtggccgaggccttcgtgatactgagatcgggagtagag
cccaatcaagggttgaaggatgagataaacaggtttgtcagggataacttcggtcccata
gcagtattcaaggacatccacttcgtctccaagttacctaaaaccaggagcggtaagata
atgaggagagttataagggcggtagctagcaattcgcccataggcgacgttacaacgctt
gaggacgaggcctcagtagatgagataaggaacgcgtacaaggaattcatgagggaggtc
aagaagtga

DBGET integrated database retrieval system