KEGG   Metallosphaera cuprina: Mcup_0954Help
Entry
Mcup_0954         CDS       T01467                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mcn  Metallosphaera cuprina
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mcn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcn00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mcn00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mcn00640]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:mcn00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:mcn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
869805..871460
Genome map
AA seq 551 aa AA seqDB search
MDYAEASKLALENPESYWSPFASKLAWYKTWDKVELNGRWFVNGETNLAENVLRHQGIAL
IWYGEGERRELSYSELSGLVEKVSSLLKERGVRRGDRVAIHMPNLPETIATMLACAKMGV
TYSVIFAGLGAAAVRARIDDLSPKLVVSTQYTQRRGNKILLLGGDLVLNRGLEPLDERTE
SERIESNEPMMIMYTSGTTGKPKGIVLPHGSWMVGHYVVFDIMFSLRPGDKVFTTADVGW
ITFSRIAYGTLLHGGTLVFMEGAPDHPRDRIPSIMREESPKVFFTSPTLLRMLRTSDVKL
ERIEYLATAGEIFDEPSWDYAMKFADKVTDVYGQSETGYVAGTPFALSVEPKKGFAGVPF
PGALLETVNENGEVVRGRPGYLILKGSFPTKFVGVWRNEAKFKEYERFGGHDTGDVAIFE
GSFLKIVGRNDDMIKIAGHRITSGEVEDLVSKIPGVRDVSAVGVPDEIKGERLILFVVGE
VSSETIREEVKTKLGPIYLVEKVIRVKRLPKSRSGKVVRRVLRDLVMNKEVDPTILEDPE
VIDEIKEAVAK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggactacgctgaggcttcaaagctagccttggagaatccagagtcttactggtccccg
ttcgcgtctaaactcgcttggtacaagacctgggataaagttgagttaaacgggaggtgg
ttcgtaaatggggagactaacttagcggaaaacgttttgaggcatcaagggatcgcgttg
atctggtacggggagggggagaggagggagctatcctattccgagctctcgggattggtg
gagaaggtttcctcactgcttaaggagaggggtgtaaggaggggagatagggtagcgata
cacatgcctaaccttcccgagaccatagcgaccatgttagcctgcgctaagatgggggta
acgtactcagtcatattcgctgggttaggagcggctgcggtaagagctaggatagacgat
ttgtccccaaagctagtggtgagcactcaatacacacagaggcgtgggaacaagatcctc
ctcttaggtggggacttggttctcaataggggattggaaccgttagacgagcggaccgag
agcgagaggatagaatcgaatgaacccatgatgatcatgtacacgtcaggaactacaggc
aagcctaaggggatagtcctacctcacggatcttggatggtagggcattacgtagtgttc
gacataatgttctcgctgagacctggagacaaagtgttcactacggctgacgtgggctgg
ataaccttctcaaggatagcttacggtacgctccttcatggaggtactctcgtgttcatg
gagggagctcctgatcaccctagagataggataccctccatcatgagggaggaaagccca
aaggtgttcttcacttctcccaccctactgaggatgctgaggacttcagacgtgaagttg
gagaggatagaatatctagccaccgccggggagatatttgacgaaccctcttgggattac
gctatgaagttcgcggataaggtaaccgacgtttacggacagtccgagactgggtacgtc
gctggaacccctttcgccctctcagtagaacctaagaagggattcgctggagtaccgttt
cctggggcacttctcgagaccgtaaacgaaaacggggaggtagtgaggggaagaccgggc
tacctaatactaaagggttcctttccaaccaagtttgtaggagtttggaggaacgaggcg
aagtttaaggagtacgaaaggttcggaggacacgatacgggagacgtggcgatatttgag
gggtctttccttaagatagtgggcaggaacgacgatatgataaagatagcgggtcacagg
ataacaagcggtgaggttgaggacctcgtatctaagatccctggagtaagggacgtatct
gcagtcggggtgcctgatgagattaagggcgagagactgattcttttcgtcgtaggagag
gtgagttcagagacgataagggaagaggtcaagacgaagttgggtccgatctacttagtg
gagaaggtgataagggttaagaggttacctaagtcgagaagcggaaaggtcgtgaggagg
gtcctgagagatctggtcatgaacaaggaggtagatcccactatattggaggaccctgag
gtaatagatgagataaaggaagctgtagctaagtga

DBGET integrated database retrieval system