KEGG   Metallosphaera cuprina: Mcup_1586Help
Entry
Mcup_1586         CDS       T01467                                 

Definition
putative pyruvate: ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mcn  Metallosphaera cuprina
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mcup_1586
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mcup_1586
   00020 Citrate cycle (TCA cycle)
    Mcup_1586
   00620 Pyruvate metabolism
    Mcup_1586
   00640 Propanoate metabolism
    Mcup_1586
   00650 Butanoate metabolism
    Mcup_1586
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mcup_1586
   00680 Methane metabolism
    Mcup_1586
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mcup_1586
Enzymes [BR:mcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mcup_1586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1436767..1437627)
Genome map
AA seq 286 aa AA seqDB search
MNAMLRGNAACPGCPIPRELDALLEMTGEKTVLVIPASCTTVIMGDTRGMPSRVPVIHSA
FAAAPAIASGVKSALDSRGEKATVVVWAGDGGTGDIGFASLSGAAERNEDILYVCYDNEA
YMNTGVQRSGLTPYGAWTTTTPSGKRERKKPLPQLIAEHNVPYVATASIAYLFDYQAKVR
KSKDIKGFRYIHLLSPCPPGWRFDSSLTIEIAKLAVDTGIWPLYEIERGKLRLTSISKTL
IDKKKRRPVTDYLKIQGRFNNLTQDEIKFIQDSVDEMWEELAKTLP
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctatgttgagaggaaacgcggcttgtccaggctgtcccattccaagggagcta
gatgcccttctggagatgacaggagaaaagaccgttctggtgataccagcttcgtgtact
acagtgataatgggcgacactagaggaatgccttctagggtgcctgtaatccatagcgct
ttcgctgcggcccccgcaatagcctccggagtaaaaagtgcattagactcaaggggagag
aaagcaactgtagtggtttgggctggagatggaggaactggtgacataggtttcgcctct
ttgagtggcgccgcagaaaggaacgaggacatactatacgtttgctatgataatgaggct
tatatgaacactggagttcagagatccggtttaactccttatggagcgtggacaactacc
accccctcagggaaaagggaaagaaagaaaccgcttccccaactcattgcagaacataac
gtaccttacgtcgccacagcgtctatagcttacctctttgactatcaagccaaagttagg
aaaagtaaagatatcaaaggttttagatacatacaccttctctcaccgtgtcctccagga
tggagatttgactcaagcctcacaattgagatcgctaagttagcagtagatacagggata
tggcctctttatgagatagagagaggaaagctaaggttaacaagcattagtaagaccctc
atagataagaagaagaggagaccggtcactgattacttaaaaatacagggtagattcaat
aatctaacacaggatgaaattaaatttattcaggacagcgtagatgagatgtgggaggag
ttggctaagacactgccttga

DBGET integrated database retrieval system