KEGG   Metallosphaera cuprina: Mcup_1589Help
Entry
Mcup_1589         CDS       T01467                                 

Definition
putative pyruvate: ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mcn  Metallosphaera cuprina
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mcn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mcn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mcn00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mcn00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mcn00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:mcn00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:mcn00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:mcn00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1439044..1439571)
Genome map
AA seq 175 aa AA seqDB search
MKGRGGQGVVTAGELLTKSVIAKGKYAQSIPFFGGERRGAPVSSEVRISDEPIPLHRRVY
NPDVVVVFDTTLIPLINPLEGLKDNGILLINSDNPKKYWKNTYYVNATEIARSLGLVVAG
WSVVNTAMLGALAEMTKVVEPELLETSVMEEFPGKLGELNAKAVFLGTKEVKSLD
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggggagaggaggtcaaggggttgttaccgctggtgagctactcactaaatcagtc
atcgctaagggaaaatatgcacagtccatacctttctttggaggggagaggagaggcgct
ccagtgagtagtgaggttagaatatctgacgaacctattcctcttcacaggagagtgtac
aacccggacgtcgtcgttgtatttgataccaccctcatcccattaatcaacccactcgag
ggattaaaagataacggaattctcttaataaattctgacaatcctaagaagtattggaaa
aacacgtattacgtaaacgcaactgagatagcgagatcgttaggcctggtagtagctgga
tggagtgttgttaacaccgctatgttaggtgcgttagcagaaatgacaaaggttgttgaa
cctgaactcctggagacttcggttatggaagagtttccagggaagctgggcgagttgaac
gcaaaggcagtgtttctaggcactaaggaggtgaaatctcttgattaa

DBGET integrated database retrieval system