KEGG   Metallosphaera cuprina: Mcup_1761Help
Entry
Mcup_1761         CDS       T01467                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00010  Glycolysis / Gluconeogenesis
mcn00020  Citrate cycle (TCA cycle)
mcn00620  Pyruvate metabolism
mcn00640  Propanoate metabolism
mcn00650  Butanoate metabolism
mcn00680  Methane metabolism
mcn00720  Carbon fixation pathways in prokaryotes
mcn01100  Metabolic pathways
mcn01120  Microbial metabolism in diverse environments
mcn01130  Biosynthesis of antibiotics
mcn01200  Carbon metabolism
Module
mcn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mcup_1761
   00020 Citrate cycle (TCA cycle)
    Mcup_1761
   00620 Pyruvate metabolism
    Mcup_1761
   00640 Propanoate metabolism
    Mcup_1761
   00650 Butanoate metabolism
    Mcup_1761
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mcup_1761
   00680 Methane metabolism
    Mcup_1761
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mcup_1761
Enzymes [BR:mcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mcup_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AEB95863
UniProt: F4G0H6
Position
complement(1606433..1606903)
Genome map
AA seq 156 aa AA seqDB search
MFASAFPIYGAERRGAEIESYCRISESQIRETSPIEEPDVVVILDPTILKISDPLKGLKA
NGKVVLNWKGSPPRVKGDLHVVDATGIAINLKLVKSGWPLVNVIMLGALVKVIGLLSLDS
LKKAIDSEFNGNVAELNKKAVEEAYHEVRKVEQLVV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
ttgttcgcctcagctttccctatttacggcgctgaaagaagaggagccgagatagagtcc
tattgtaggatctctgagtctcaaattagggagacctcgcctattgaggagcccgatgtt
gttgtaattcttgatccaacaattttgaaaatatctgacccacttaagggattaaaggct
aacggtaaggtcgtgttaaattggaaaggatcacccccaagagttaaaggagatctacat
gtggtagacgcaacaggtattgcaattaacctgaagctagtgaagtccggttggcctcta
gttaacgtaataatgttaggggctctggttaaagtgatcggattactttccttggactca
ctgaagaaagctatagactctgagtttaatggaaatgttgcagagttgaacaagaaggcg
gtagaagaggcttatcatgaggtgagaaaggttgagcagcttgtcgtttga

DBGET integrated database retrieval system