KEGG   Metallosphaera cuprina: Mcup_1849Help
Entry
Mcup_1849         CDS       T01467                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/subunit
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mcn  Metallosphaera cuprina
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mcup_1849
   00030 Pentose phosphate pathway
    Mcup_1849
   00051 Fructose and mannose metabolism
    Mcup_1849
   00052 Galactose metabolism
    Mcup_1849
   00500 Starch and sucrose metabolism
    Mcup_1849
   00520 Amino sugar and nucleotide sugar metabolism
    Mcup_1849
  Nucleotide metabolism
   00230 Purine metabolism
    Mcup_1849
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mcup_1849
Enzymes [BR:mcn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mcup_1849
    5.4.2.8  phosphomannomutase
     Mcup_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1683271..1684635)
Genome map
AA seq 454 aa AA seqDB search
MGKLFGTDGVRGVVNQELTIELAQGLGKAIGTFFGEGSVLLIGRDARAGGDMITRAVESG
LLSTGVRVYEGGFAPTPALQYAVKTLGYDGGVIITASHNPRGHNGIKVLDKDGVEVDREK
EDSIEEIFFSSRFNLVSWNKLTYDVMREDKVIDTYVKGILSHVNVEKIRSKNFKVLIDGA
NSVGSISTPLIARLLGCRVYTLNANLEPTFPARNPEPTMDTLKESAQVSANLGVDITVAH
DGDADRAIFVDSRGRIQWGDRSGALLSWWASKKEDFPKRIFTAVSSSSLVQEFLSKFGIE
VIWTKVGSVDIARKLIQEKGIAGFEENGGFIFPLHQYVRDGAMSFALMLEMMAEEGVSSA
ELFDRLPQYHLVKSKVDLKPGMDVGKIYATVEREFGSGNHIVKIDGIKIISKDFWILVRK
SGTEPIIRVMVEAKDQDVAEGLSKKVISLIGGSS
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagttatttggtactgatggagttagaggggttgtaaatcaagaactgaccatt
gagttggctcagggtttagggaaggccataggtaccttctttggtgaaggaagtgtatta
ctcataggaagggatgctagagcaggtggagatatgataacgagggctgtggagagcggc
cttctaagcactggggtaagagtatatgaagggggcttcgccccaactcctgcccttcaa
tacgctgtaaagactctaggatatgatggaggcgtaataataacagcgagtcacaatcca
agggggcataacggaataaaggttcttgacaaagacggggtggaagtagatagagagaaa
gaggattctattgaagaaattttcttctctagtagatttaatttggtatcttggaataaa
ctgacatacgatgttatgcgagaagataaagttattgatacctacgtcaagggtattcta
tctcatgttaacgtagagaagataagatcaaagaatttcaaagttttaatagatggagct
aacagcgttggatccatttctacccctcttatagctagacttttagggtgtagagtttac
acactgaacgccaacttagagcctacatttccagcaaggaatccggaacccactatggac
accttaaaggagtcagcccaagtttcagctaatctcggtgtagacattacagtagcacat
gatggagacgccgacagagcaatatttgtagactcaagagggaggatccaatggggagat
aggagcggggctctacttagttggtgggcttctaaaaaggaagattttcctaaaaggata
ttcacagctgtatctagttcgtctctggttcaggagttcttaagtaagtttggaatagaa
gttatatggaccaaagtgggaagtgtagacatagcaaggaaattaatacaagagaagggc
atagctggttttgaagagaacggcggtttcatttttccgttacatcaatacgttagagat
ggggctatgagctttgcactcatgttggagatgatggcagaggaaggggtgagctcagca
gaacttttcgatcgccttcctcaatatcacttagttaaatctaaggtggatcttaaacct
ggaatggacgtaggtaagatttacgcaacagttgagagggagtttggatcaggcaatcat
attgtaaagatagatggaataaaaatcatatcaaaagatttctggattttagtgaggaaa
agtggaacggagcccatcataagggtaatggttgaggctaaagaccaagacgtagcggaa
ggtctaagtaaaaaagtgatcagtttgataggtgggtcttcatga

DBGET integrated database retrieval system