KEGG   Metallosphaera cuprina: Mcup_1857Help
Entry
Mcup_1857         CDS       T01467                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mcn  Metallosphaera cuprina
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mcup_1857
Enzymes [BR:mcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mcup_1857
Exosome [BR:mcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mcup_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1691896..1692843)
Genome map
AA seq 315 aa AA seqDB search
MAETRLTADNLILPVFIKDGISQPEEIGSMPGILRYPPNDHLIKFVDENFNKGITKLVVF
GIPSFKDNIASSAFQKDGVIQRSLRLLKQTFGEKIVLIADECTDEYTSHGHCGIVNYRGS
NYYIDNDESIKVHAKIALSQAEAGADVIAPSSMMDGVVGAIRKELDDNGFQDTLIMAYSV
KYASVFYSPFREAASSAPAFGDRKSYQMDPRNSYEALKEAKLDIEEGADILMVKPAHTYL
DVIRLVKDTFSTYPLAAYHVSGEYSMIKAAVKNGWLNERNAVMEITYSIKRAGADLILTY
YAPQLAEWIREGTPF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaaacgaggttaacggcagataacctaatcttaccggtctttataaaagacggg
atctcgcagcctgaagagataggtagtatgcccggaatcttaaggtatccgcccaacgat
cacctcataaagtttgtagatgagaacttcaataaaggtataacgaaactagttgtcttt
ggaataccttcattcaaagataatattgctagttcagcttttcaaaaggacggtgtaata
cagcgatctctaaggttgttaaagcaaacttttggggaaaagatagttctaatagctgac
gagtgcacagatgagtatacatctcatggacactgcgggattgtaaactacagaggcagt
aactactacatagataacgacgaaagtattaaagtccacgctaagatagccctttctcag
gccgaggctggggcggacgtgatcgccccctctagtatgatggacggtgttgtaggggca
ataaggaaagagttggacgataacggtttccaagacactctcatcatggcttatagtgta
aagtacgcgtcggtgttttattctccgtttagagaggcagcttcttccgcccccgctttt
ggggacagaaagagctatcagatggaccccaggaactcatatgaagcgctaaaggaagct
aaacttgacattgaggaaggtgccgacatcttaatggttaagccggctcacacctatctc
gacgtcataaggttagttaaggatacgttttccacatatcccctagcggcttatcacgta
agcggagagtactccatgataaaggccgcagttaaaaacggatggttaaatgagagaaat
gcggtgatggaaataacttattcgatcaaaagggctggcgcggatctaatactaacctat
tatgctcctcaattggccgaatggattagggaggggactccattttga

DBGET integrated database retrieval system