KEGG   Metallosphaera cuprina: Mcup_2006Help
Entry
Mcup_2006         CDS       T01467                                 

Definition
(GenBank) D-fructose 1,6-bisphosphate aldolase/phosphatase
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00010  Glycolysis / Gluconeogenesis
mcn00030  Pentose phosphate pathway
mcn00051  Fructose and mannose metabolism
mcn00680  Methane metabolism
mcn01100  Metabolic pathways
mcn01110  Biosynthesis of secondary metabolites
mcn01120  Microbial metabolism in diverse environments
mcn01130  Biosynthesis of antibiotics
mcn01200  Carbon metabolism
mcn01230  Biosynthesis of amino acids
Module
mcn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mcup_2006
   00030 Pentose phosphate pathway
    Mcup_2006
   00051 Fructose and mannose metabolism
    Mcup_2006
  Energy metabolism
   00680 Methane metabolism
    Mcup_2006
Enzymes [BR:mcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mcup_2006
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mcup_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEB96108
UniProt: F4G231
Position
1815517..1816665
Genome map
AA seq 382 aa AA seqDB search
MRSTVSVIKADIGSLAGHHVVHPDTMAAANRVLADAKRQGIILDYYITNVGDDLELIMSH
TRGELDTKVHETAWSAFKEATKVSKELGLYAAGQDLLSDTFSGNLKGMGPGIAELEVEER
PSEPIAIFMADKTEPGAFNFPLYKMFCDPFNTPGLVIDPTMNEGFKLEVLDVYEGQSVLL
NSPEEIYYLLGLIGTMARYVIRRVYRKADNMIGSVTSIERLNLIAGKYVGKDDPVLIVRL
QHGFPALGEALEAFSFPYLVPGWMRGSHYGPLMPVSQRDAKATRFDGPPRLIGLGFNLKN
GKLTGPSDLFDDPAFDETRRVAAIMTDYMRRHGPFMPHRLEPTEMEYTTLPTIIEKLKDR
FKKEDSVKAKPSVYASKDQGMD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagatctacggtaagtgtaataaaggcggacattggaagtctagctggccatcatgta
gtacatccagacacaatggccgcagctaatagggtattggcagatgcaaaaaggcaagga
ataattctagactattatattacaaacgttggtgatgatctagagcttatcatgagccat
actagaggcgaacttgacactaaggttcatgaaacggcatggagcgctttcaaggaagcg
acaaaggtctccaaagaacttggactttatgcggcaggacaagacttgttatcagataca
ttctctggtaacctaaaggggatgggaccaggaatagctgaactggaagttgaggagagg
ccatctgaaccaatcgcaatattcatggctgataagactgagcctggagccttcaatttc
ccgctctataagatgttttgtgatccttttaatacgccaggcttagtaatagaccctact
atgaacgaggggtttaaattagaggttttagacgtgtatgaaggccagagcgtcttattg
aatagtccagaggaaatatactatcttcttggtctaataggaactatggctagatatgta
ataagaagagtttatagaaaagcagacaacatgattggatccgttacgtctatcgagaga
cttaacctaatagctgggaagtatgttggtaaagacgatccagtgttgatagtgagatta
cagcatggatttccagcattaggagaggcgttagaggctttttccttcccttacttggtt
ccaggatggatgcgcggaagccactatggtcctctcatgcctgtttcgcaaagggatgca
aaagctactagatttgatgggccgcctagattgattggattaggatttaacctaaagaat
ggaaaactgactggaccttctgatttatttgatgatccagccttcgatgaaactagaagg
gttgcagctataatgacagattacatgagaagacatggaccttttatgccacacagactc
gaaccaacagaaatggaatatacaactttacctactattatagagaaattaaaagataga
ttcaagaaagaagatagcgtaaaagcaaagcctagtgtatatgcatcaaaggaccaaggt
atggactag

DBGET integrated database retrieval system