KEGG   Mycoplasma conjunctivae: MCJ_000230Help
Entry
MCJ_000230        CDS       T00919                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mco  Mycoplasma conjunctivae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mco00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MCJ_000230 (glpK)
Enzymes [BR:mco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MCJ_000230 (glpK)
Exosome [BR:mco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MCJ_000230 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24589..26106
Genome map
AA seq 505 aa AA seqDB search
MNDKYIITLDSGTTSCRSLIVDHKGEVVATSQAEFGQIFPQSGWVEHNPLEIWNTQLSTM
QTVKSKAKIKSHNIAGLGITNQRETIVLWDKLTGLPVYNAIVWQDRRTAQFCQELIEQGW
SDKINSKTGLIINPYFSATKIRWILQNVELAKEKLAQGRLLAGTIDTWLIWKLTNGKVHA
TDVSNASRTMLFNIHTLDWDQEILDLLEIPREILPEVKSSADDFGKVEPEFWSKNSQTYV
PISGVAGDQQSALFGQLCTEVGMVKNTYGTGCFTLVNTGEQAVKSKNKLLTTIAWKIKNQ
PVIYALEGSVFIAGAAIQWLRDSIKIIYNAAESDFFASLVKDDQRVYLVPSFTGLGAPYW
DSYSRGAIFGLERGTKREHIIKATLDSIAYQSNDLIKAMEKDLNKPIIALKVDGGASNSN
YLMQFQSSISNVEVWRPKNIETTALGASYLAGLSVGFWKNIEEIKQLYIPDRVFKPQLDK
STVDKLVKGWDTAVSKTLNWTKDIE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacgataaatacattattacccttgattcaggaactacatcttgccgtagtttaatt
gttgatcataaaggtgaagtagttgcaacaagtcaggctgaatttggtcaaatatttcca
caatcagggtgagtagaacacaacccactagaaatatgaaatactcagctttcaactatg
caaacagttaaaagtaaagctaaaattaaatctcacaatattgccggtttaggaatcact
aaccaaagagagacaattgttttatgagataaattaactggacttcctgtttataacgct
attgtttgacaagatcgccgaactgcacaattttgtcaagaattaattgaacagggctga
tctgataagattaattcaaaaaccggacttattattaacccttattttagtgcaactaaa
attcgttgaattttacaaaatgttgaacttgcaaaagaaaaacttgctcaaggcagatta
ctagcgggaacaattgatacttgactaatttgaaaattaacaaatggaaaagttcatgca
actgatgtctccaacgcctcaagaacaatgttatttaacattcacacccttgactgagat
caagaaattttagatctacttgaaattccaagagaaatattgccagaagttaaatcttca
gctgatgattttggaaaagtagaacccgaattttgatcaaaaaattctcaaacatacgtt
ccaatttcaggagttgctggtgaccaacaatcagcattatttggacaactatgtacagaa
gtaggaatggttaaaaatacctatggaactggatgttttactttggtaaacacaggtgaa
caagcagttaaaagtaaaaataaattattaacaaccattgcttgaaaaattaaaaatcaa
ccagttatttatgcactcgaaggttctgtttttatcgcaggagctgctatccaatgactt
cgtgattcaattaaaattatttataatgcagcagaatcagacttttttgcctcattagtt
aaagatgatcaaagagtttatttagtaccttcttttacaggacttggtgcaccttactga
gattcatactcacgtggagctatcttcggacttgaaagaggaactaaacgtgaacacatt
attaaagcaactttggactccatagcttaccaatcaaacgacttaattaaagcaatggaa
aaagatttaaacaaacctattattgccctcaaagttgatggtggagcttcaaattctaac
tacttaatgcaattccaatcttcaatttctaatgtcgaagtttgaaggcctaaaaacatt
gaaactaccgcacttggagcttcatatctagcaggtctaagtgttggattttgaaaaaac
attgaggaaattaaacaactttacattccagacagagttttcaaacctcaacttgataaa
tcaacagttgacaaacttgtcaaaggttgagacaccgcagttagcaaaactctaaactga
acaaaggatattgaataa

DBGET integrated database retrieval system