KEGG   Mycoplasma conjunctivae: MCJ_000690Help
Entry
MCJ_000690        CDS       T00919                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mco  Mycoplasma conjunctivae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mco01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mco00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mco00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mco00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
68308..69234
Genome map
AA seq 308 aa AA seqDB search
MSKIFATPVAKRLIKEHNLNIDEIPFSKSRIEKEDVEKYIESLKSAPTPSAPASTPSVAS
APTPTPAPVAKPVATLDGRREKIAPIRKAIARAMRTSWESVAYVNLVNEIDMSALWNLRK
SILDDVLKSSGVKLTFLPFIAKAILIALQEFPIIAAKYDEASQEIVYPATINLGFAVDTE
AGLMVPVIKDAQSLSMIEIAKEISRLAIAARDRKIKPTEMQGGSFTITNYGSVGALYGVP
VINYPEMGIAGVGAIIDKAIVKNGQIVPGKIMHLTVAADHRWIDGATIGRFAARVKELLE
KPEVLGIL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatatttgccactccagtagctaaaaggttgataaaagaacacaatttaaat
attgatgaaattccttttagtaaatctcgaattgaaaaagaagatgttgaaaaatacatt
gaaagtttaaaaagtgcaccaactccaagtgcacctgcaagcactccaagtgtagcatca
gctccaacaccaactccagctcctgttgcaaaaccagttgccactttagatggtcgtcgt
gaaaaaattgcaccaattagaaaagcaatcgctcgtgcaatgcgtacttcatgagaatca
gttgcttatgttaatttagttaatgaaattgatatgagtgccctttgaaatttaagaaaa
tctatcttagatgatgtcttaaagtcttctggagttaaattaacttttctaccttttata
gcaaaagcaatcctaattgctttacaagaatttccaattattgcagctaaatatgatgaa
gctagccaagaaattgtctacccagcaactattaatttaggatttgcagttgacactgaa
gctggactaatggtgccagtaataaaagatgcccaaagtctttcaatgattgaaattgcc
aaagaaatttcccgtcttgcaattgcagctcgtgatcgtaaaattaaaccaacagaaatg
caaggtggttcctttaccattaccaattatggttcagtaggtgccctttacggagttcca
gttattaactacccagaaatgggaatcgccggagttggtgctatcattgacaaagcgata
gtaaaaaatggtcaaatcgtgccaggaaaaattatgcacttaacagtagctgctgatcac
cgttgaattgatggcgctacaattggtcgttttgctgcaagagttaaagaattattagaa
aaaccagaagtattaggaattttataa

DBGET integrated database retrieval system