KEGG   Mycoplasma conjunctivae: MCJ_000690Help
Entry
MCJ_000690        CDS       T00919                                 

Gene name
pdhC
Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mco  Mycoplasma conjunctivae
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCJ_000690 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCJ_000690 (pdhC)
   00020 Citrate cycle (TCA cycle)
    MCJ_000690 (pdhC)
   00620 Pyruvate metabolism
    MCJ_000690 (pdhC)
Enzymes [BR:mco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MCJ_000690 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
68308..69234
Genome map
AA seq 308 aa AA seqDB search
MSKIFATPVAKRLIKEHNLNIDEIPFSKSRIEKEDVEKYIESLKSAPTPSAPASTPSVAS
APTPTPAPVAKPVATLDGRREKIAPIRKAIARAMRTSWESVAYVNLVNEIDMSALWNLRK
SILDDVLKSSGVKLTFLPFIAKAILIALQEFPIIAAKYDEASQEIVYPATINLGFAVDTE
AGLMVPVIKDAQSLSMIEIAKEISRLAIAARDRKIKPTEMQGGSFTITNYGSVGALYGVP
VINYPEMGIAGVGAIIDKAIVKNGQIVPGKIMHLTVAADHRWIDGATIGRFAARVKELLE
KPEVLGIL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatatttgccactccagtagctaaaaggttgataaaagaacacaatttaaat
attgatgaaattccttttagtaaatctcgaattgaaaaagaagatgttgaaaaatacatt
gaaagtttaaaaagtgcaccaactccaagtgcacctgcaagcactccaagtgtagcatca
gctccaacaccaactccagctcctgttgcaaaaccagttgccactttagatggtcgtcgt
gaaaaaattgcaccaattagaaaagcaatcgctcgtgcaatgcgtacttcatgagaatca
gttgcttatgttaatttagttaatgaaattgatatgagtgccctttgaaatttaagaaaa
tctatcttagatgatgtcttaaagtcttctggagttaaattaacttttctaccttttata
gcaaaagcaatcctaattgctttacaagaatttccaattattgcagctaaatatgatgaa
gctagccaagaaattgtctacccagcaactattaatttaggatttgcagttgacactgaa
gctggactaatggtgccagtaataaaagatgcccaaagtctttcaatgattgaaattgcc
aaagaaatttcccgtcttgcaattgcagctcgtgatcgtaaaattaaaccaacagaaatg
caaggtggttcctttaccattaccaattatggttcagtaggtgccctttacggagttcca
gttattaactacccagaaatgggaatcgccggagttggtgctatcattgacaaagcgata
gtaaaaaatggtcaaatcgtgccaggaaaaattatgcacttaacagtagctgctgatcac
cgttgaattgatggcgctacaattggtcgttttgctgcaagagttaaagaattattagaa
aaaccagaagtattaggaattttataa

DBGET integrated database retrieval system