KEGG   Mycoplasma conjunctivae: MCJ_000850Help
Entry
MCJ_000850        CDS       T00919                                 

Gene name
tpiA
Definition
(RefSeq) Triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mco  Mycoplasma conjunctivae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCJ_000850 (tpiA)
   01230 Biosynthesis of amino acids
    MCJ_000850 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCJ_000850 (tpiA)
   00051 Fructose and mannose metabolism
    MCJ_000850 (tpiA)
   00562 Inositol phosphate metabolism
    MCJ_000850 (tpiA)
Enzymes [BR:mco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MCJ_000850 (tpiA)
Exosome [BR:mco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MCJ_000850 (tpiA)
  Exosomal proteins of bladder cancer cells
   MCJ_000850 (tpiA)
  Exosomal proteins of melanoma cells
   MCJ_000850 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84216..84944
Genome map
AA seq 242 aa AA seqDB search
MKKIIIGNWKMNKNLEQTRDFVFKFEQLYKQNEAKIIDLDFAVAPPTINAFALKDTNVKQ
LKLALQNISEFESGAYTGEISASMAKNIGAQYIIIGHSERRSLFNESDFQVATKAKIAIK
HELTPVICVGETLQEYESQQTEEVISRQIRDSLEGVDLSKIIIAYEPIWAIGTGKTATPE
QAEKVCAFIKKLIDNQAPVLYGGSVSPQNILDILKKKNIDGALVGGASLEAESFINLLTL
NK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcattattggtaattgaaaaatgaacaaaaatcttgaacaaacaagggat
tttgtctttaaatttgaacaactttacaaacaaaatgaagctaaaattattgatctagac
tttgcagttgcaccaccgacaattaatgcttttgcactcaaagatacaaatgtaaaacaa
cttaagttagcacttcaaaatataagcgaatttgaatcaggagcatatactggtgaaatt
tcagcatctatggcaaaaaatatcggagcccaatacatcatcattggacattcagagcgt
agaagtctttttaatgaaagtgattttcaagtagctactaaagcaaaaattgctatcaaa
cacgagctaactccagttatatgtgtaggagaaacattgcaagaatacgaaagtcaacaa
actgaagaagttattagtagacaaattcgtgattctttagaaggtgtagatcttagtaaa
ataattattgcttatgagccaatttgagctataggaactggaaaaacagcaactcccgaa
caggctgaaaaggtttgtgcttttattaaaaaactaattgataatcaagcacctgttttg
tatggaggttcagtaagtccacaaaatattttagatattttgaagaaaaaaaacattgat
ggggcactagtaggaggtgcatcactagaggctgaatcatttattaatttactaacatta
aataaataa

DBGET integrated database retrieval system