KEGG   Mycoplasma conjunctivae: MCJ_000850Help
Entry
MCJ_000850        CDS       T00919                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mco  Mycoplasma conjunctivae
Pathway
mco00010  Glycolysis / Gluconeogenesis
mco00051  Fructose and mannose metabolism
mco01100  Metabolic pathways
mco01110  Biosynthesis of secondary metabolites
mco01120  Microbial metabolism in diverse environments
mco01130  Biosynthesis of antibiotics
mco01200  Carbon metabolism
mco01230  Biosynthesis of amino acids
Module
mco_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCJ_000850 (tpiA)
   00051 Fructose and mannose metabolism
    MCJ_000850 (tpiA)
   00562 Inositol phosphate metabolism
    MCJ_000850 (tpiA)
Enzymes [BR:mco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MCJ_000850 (tpiA)
Exosome [BR:mco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MCJ_000850 (tpiA)
  Exosomal proteins of bladder cancer cells
   MCJ_000850 (tpiA)
  Exosomal proteins of melanoma cells
   MCJ_000850 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAT04760
UniProt: C5J5N7
Position
84216..84944
Genome map
AA seq 242 aa AA seqDB search
MKKIIIGNWKMNKNLEQTRDFVFKFEQLYKQNEAKIIDLDFAVAPPTINAFALKDTNVKQ
LKLALQNISEFESGAYTGEISASMAKNIGAQYIIIGHSERRSLFNESDFQVATKAKIAIK
HELTPVICVGETLQEYESQQTEEVISRQIRDSLEGVDLSKIIIAYEPIWAIGTGKTATPE
QAEKVCAFIKKLIDNQAPVLYGGSVSPQNILDILKKKNIDGALVGGASLEAESFINLLTL
NK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcattattggtaattgaaaaatgaacaaaaatcttgaacaaacaagggat
tttgtctttaaatttgaacaactttacaaacaaaatgaagctaaaattattgatctagac
tttgcagttgcaccaccgacaattaatgcttttgcactcaaagatacaaatgtaaaacaa
cttaagttagcacttcaaaatataagcgaatttgaatcaggagcatatactggtgaaatt
tcagcatctatggcaaaaaatatcggagcccaatacatcatcattggacattcagagcgt
agaagtctttttaatgaaagtgattttcaagtagctactaaagcaaaaattgctatcaaa
cacgagctaactccagttatatgtgtaggagaaacattgcaagaatacgaaagtcaacaa
actgaagaagttattagtagacaaattcgtgattctttagaaggtgtagatcttagtaaa
ataattattgcttatgagccaatttgagctataggaactggaaaaacagcaactcccgaa
caggctgaaaaggtttgtgcttttattaaaaaactaattgataatcaagcacctgttttg
tatggaggttcagtaagtccacaaaatattttagatattttgaagaaaaaaaacattgat
ggggcactagtaggaggtgcatcactagaggctgaatcatttattaatttactaacatta
aataaataa

DBGET integrated database retrieval system