KEGG   Mycoplasma conjunctivae: MCJ_006120Help
Entry
MCJ_006120        CDS       T00919                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mco  Mycoplasma conjunctivae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MCJ_006120 (galU)
   00052 Galactose metabolism
    MCJ_006120 (galU)
   00500 Starch and sucrose metabolism
    MCJ_006120 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MCJ_006120 (galU)
Enzymes [BR:mco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MCJ_006120 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
719790..720662
Genome map
AA seq 290 aa AA seqDB search
MKVKKCIIPAAGWGTRFLPLTKIVHKELVPVLAKPIIDYLIQEAFDAGIEEVYLILSPRK
VEIMDYFRKYDALEEQLESQRKDELLKIVRTTNREAKIKVVYQNEQLGLGHAIAVARHKI
KNEPFAVILGDDLIDSKTPCIADLIEVYKKTNSSVVGVTDIEISESNKYGIVIPKDQKQR
NESIFEISGAIEKPNPEVAPSNKAIIGRYVFTPEIMNILANLKPGVNNEIQLADAFTNLL
KNQSIYAFNIKDQRYDLGSVEGFIKANIDFALKDPSLKETITNFLKSKKL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaaaaatgtattattccagcggccggctgaggaacaagatttctaccgcta
acaaaaattgttcacaaagagttagttcctgttttagcaaagccaataattgactattta
attcaagaagcttttgatgccggaattgaagaagtctacctaattttatcgccaagaaaa
gtcgaaattatggattattttcgcaaatatgacgctcttgaagaacaactagaatcacaa
agaaaagatgaattattgaaaattgttagaactacaaatagagaagctaaaataaaagtt
gtttatcaaaatgaacaattaggactaggacatgcaattgcagttgctagacataaaata
aaaaatgaaccttttgcagttattctcggtgatgacttaatagattctaaaactccttgc
attgctgatttaatagaagtttataaaaaaactaattcatcggttgtaggagtaactgac
attgaaatttctgaatcaaataaatatggtattgtaataccaaaagatcaaaaacaaaga
aatgaaagcatttttgaaattagcggagcaattgaaaaaccaaatcctgaggtagcacct
tcaaacaaagctattattggtcgttatgtcttcacacctgaaattatgaatattttagca
aatttaaaaccaggagtaaacaacgaaattcaacttgcagatgcttttacaaatttatta
aaaaatcaatcaatttatgcatttaatatcaaagatcaaagatatgatttaggaagtgtt
gaaggttttatcaaggcaaatattgattttgcgctcaaagacccttctttaaaagaaaca
attacaaattttcttaaatctaaaaaattataa

DBGET integrated database retrieval system