KEGG   Mycoplasma conjunctivae: MCJ_006290Help
Entry
MCJ_006290        CDS       T00919                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mco  Mycoplasma conjunctivae
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mco00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
734842..735426
Genome map
AA seq 194 aa AA seqDB search
MSKLVILVGPSGVGKGTIESILFKNKNLKLKLSISATTRAKRPTEQDGINYYFLDKQDFE
NRIKNDEFLEWNAHFDNYYGTLKSQIKDIQNQGFLPLLEIDTNGAIKIIEKFKKEGKEND
LLTIFILPPSLQVLKERIKNRLTETDEEIAKRLQKAKEEILQKHFFQYHVVNEDLNSCVA
KIEKILLDNRKESK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagttattttagttgggccttcaggagttggtaaaggcacaattgaatca
atattatttaaaaataaaaatttaaaattaaaattgtcgatatctgctaccacaagagcc
aaaagacctactgaacaagatggtattaattattattttttagacaaacaagattttgaa
aatcgtattaaaaacgatgagtttttagaatgaaatgctcattttgataattattatggc
actctaaaatcacaaattaaagacattcaaaatcaaggttttttgccattgttagaaatt
gacacaaatggtgctatcaaaattattgaaaagttcaaaaaagaaggtaaagaaaacgat
ttgctaaccatttttatactacctccttcactccaagtgttaaaagaaagaattaaaaat
cgcttaaccgaaacagatgaagaaattgcaaaaagactacagaaagcaaaagaagaaatt
ttacaaaaacacttttttcaataccatgttgttaatgaagatttgaattcttgcgtagcc
aaaattgaaaaaatattgctagacaacagaaaagagagcaaataa

DBGET integrated database retrieval system