KEGG   Mycoplasma conjunctivae: MCJ_006290Help
Entry
MCJ_006290        CDS       T00919                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mco  Mycoplasma conjunctivae
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MCJ_006290 (gmk)
Enzymes [BR:mco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MCJ_006290 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
734842..735426
Genome map
AA seq 194 aa AA seqDB search
MSKLVILVGPSGVGKGTIESILFKNKNLKLKLSISATTRAKRPTEQDGINYYFLDKQDFE
NRIKNDEFLEWNAHFDNYYGTLKSQIKDIQNQGFLPLLEIDTNGAIKIIEKFKKEGKEND
LLTIFILPPSLQVLKERIKNRLTETDEEIAKRLQKAKEEILQKHFFQYHVVNEDLNSCVA
KIEKILLDNRKESK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagttagttattttagttgggccttcaggagttggtaaaggcacaattgaatca
atattatttaaaaataaaaatttaaaattaaaattgtcgatatctgctaccacaagagcc
aaaagacctactgaacaagatggtattaattattattttttagacaaacaagattttgaa
aatcgtattaaaaacgatgagtttttagaatgaaatgctcattttgataattattatggc
actctaaaatcacaaattaaagacattcaaaatcaaggttttttgccattgttagaaatt
gacacaaatggtgctatcaaaattattgaaaagttcaaaaaagaaggtaaagaaaacgat
ttgctaaccatttttatactacctccttcactccaagtgttaaaagaaagaattaaaaat
cgcttaaccgaaacagatgaagaaattgcaaaaagactacagaaagcaaaagaagaaatt
ttacaaaaacacttttttcaataccatgttgttaatgaagatttgaattcttgcgtagcc
aaaattgaaaaaatattgctagacaacagaaaagagagcaaataa

DBGET integrated database retrieval system