KEGG   Mycoplasma capricolum: MCAP_0009Help
Entry
MCAP_0009         CDS       T00309                                 

Gene name
recM
Definition
DNA repair protein RecM
Orthology
K06187  
recombination protein RecR
Organism
mcp  Mycoplasma capricolum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCAP_0009 (recM)
DNA repair and recombination proteins [BR:mcp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MCAP_0009 (recM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
7862..8452
Genome map
AA seq 196 aa AA seqDB search
MPESIFNEIVESIRTNEGLTKKTSERLLVNLLLNKDKLDEFINQLNKVNQLISTCKICGY
LSENNKCLVCSLDNRNQNTICIVSTILDAKNIENANKYKGVYHILNGEINLNKNITFDKL
NISSIFKRINDDTEIILALNSTFEGELTANYLYKLLSTKNIKITRLAKGIPMGASLDYMD
EFTLQSAFINRKKYGE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaagtatatttaatgaaattgtagaatcaattagaactaatgaaggattaact
aaaaaaacttcagaaagattattagtaaatttgttactaaataaagataaacttgatgaa
tttattaatcaattaaacaaagttaatcaattaatttcaacttgtaaaatatgtgggtat
ttaagtgagaataataaatgtttagtatgtagtttagataatagaaatcaaaatacaatt
tgtatagtttcaacaattttagatgcaaaaaacatagaaaatgctaataaatacaaagga
gtttatcatattttaaatggtgagattaatctaaataaaaacattacatttgataaatta
aatattagttctatttttaaaagaattaatgatgatactgaaattattttagctttaaat
tctacttttgaaggtgagttaactgctaattatttatacaaattactaagtactaaaaac
attaaaattacaagattagctaaaggaataccaatgggagctagtttagattatatggat
gaattcactttacaaagtgcatttattaatagaaaaaaatatggagaataa

DBGET integrated database retrieval system