KEGG   Mycoplasma capricolum subsp. capricolum ATCC 27343: MCAP_0009Help
Entry
MCAP_0009         CDS       T00309                                 

Gene name
recM
Definition
(RefSeq) DNA repair protein RecM
  KO
K06187  
recombination protein RecR
Organism
mcp  Mycoplasma capricolum subsp. capricolum ATCC 27343
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MCAP_0009 (recM)
DNA repair and recombination proteins [BR:mcp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MCAP_0009 (recM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7862..8452
Genome map
AA seq 196 aa AA seqDB search
MPESIFNEIVESIRTNEGLTKKTSERLLVNLLLNKDKLDEFINQLNKVNQLISTCKICGY
LSENNKCLVCSLDNRNQNTICIVSTILDAKNIENANKYKGVYHILNGEINLNKNITFDKL
NISSIFKRINDDTEIILALNSTFEGELTANYLYKLLSTKNIKITRLAKGIPMGASLDYMD
EFTLQSAFINRKKYGE
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgccagaaagtatatttaatgaaattgtagaatcaattagaactaatgaaggattaact
aaaaaaacttcagaaagattattagtaaatttgttactaaataaagataaacttgatgaa
tttattaatcaattaaacaaagttaatcaattaatttcaacttgtaaaatatgtgggtat
ttaagtgagaataataaatgtttagtatgtagtttagataatagaaatcaaaatacaatt
tgtatagtttcaacaattttagatgcaaaaaacatagaaaatgctaataaatacaaagga
gtttatcatattttaaatggtgagattaatctaaataaaaacattacatttgataaatta
aatattagttctatttttaaaagaattaatgatgatactgaaattattttagctttaaat
tctacttttgaaggtgagttaactgctaattatttatacaaattactaagtactaaaaac
attaaaattacaagattagctaaaggaataccaatgggagctagtttagattatatggat
gaattcactttacaaagtgcatttattaatagaaaaaaatatggagaataa

DBGET integrated database retrieval system