KEGG   Mycoplasma capricolum: MCAP_0064Help
Entry
MCAP_0064         CDS       T00309                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mcp  Mycoplasma capricolum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MCAP_0064
   00052 Galactose metabolism
    MCAP_0064
   00500 Starch and sucrose metabolism
    MCAP_0064
   00520 Amino sugar and nucleotide sugar metabolism
    MCAP_0064
Enzymes [BR:mcp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MCAP_0064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
76352..77230
Genome map
AA seq 292 aa AA seqDB search
MKIRKAIIPCAGFGTRFLPFTKSQAKEMLPIIDKPAIEFIVKEAINSGIEEILIIIRAGK
NHIANHFNRNIELEYFLAEKNKISELQLISEKYNATIYYLIQEEQLGLGHAISLAKDFIK
DEPFAVLLGDDLFKCKIPAIKQLIEIYDKYHQNVLGTIYIDKQNSKKYGICQGNLVSKDV
YKVDLVVEKPEPENSPSNIAIGGRYVLLPEVFKYLDMKIKGKSGEIELTDSILKTMDESE
CYAKIIDGSRYDIGNKLGYLDAILDFGLEREDLKEEFLDLIETKVEKTSSNN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagctattattccttgtgctggatttggtactagatttttacccttt
actaaatcacaagcaaaagaaatgctgcctataatagacaaacctgctatagaatttatt
gttaaagaggcaataaatagcggtattgaagaaattttaattataatacgcgctggaaaa
aatcatatagcaaaccattttaatagaaatattgaattagaatactttttagcagaaaaa
aataaaataagtgaattacaactaataagtgaaaaatataacgcaacaatttattatcta
attcaagaagaacaacttggtttaggacatgctatttctttagcaaaagattttataaaa
gatgaaccatttgctgtgcttttaggtgatgatttatttaaatgtaaaataccagctatt
aagcaattaatagaaatttatgataagtatcatcaaaatgttcttggtactatttatatt
gataagcaaaatagcaaaaaatatggaatttgtcaaggtaatttagtttcaaaagatgtt
tataaagttgatttagttgttgaaaagccagaaccagaaaattccccaagtaatattgca
attggtggaagatatgttttattacctgaagtatttaaatatttagatatgaaaataaaa
ggtaaaagtggtgaaattgaattaactgattcaattttaaaaacaatggatgaatctgag
tgttatgctaagataattgatggttcaagatatgatattggaaataaattaggttatctt
gatgctattttagattttggtttagaaagagaagatttaaaagaagagtttttagattta
atagaaaccaaagttgaaaaaacatcatcaaacaattag

DBGET integrated database retrieval system