KEGG   Mycoplasma capricolum: MCAP_0064Help
Entry
MCAP_0064         CDS       T00309                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mcp  Mycoplasma capricolum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mcp00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mcp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mcp00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
76352..77230
Genome map
AA seq 292 aa AA seqDB search
MKIRKAIIPCAGFGTRFLPFTKSQAKEMLPIIDKPAIEFIVKEAINSGIEEILIIIRAGK
NHIANHFNRNIELEYFLAEKNKISELQLISEKYNATIYYLIQEEQLGLGHAISLAKDFIK
DEPFAVLLGDDLFKCKIPAIKQLIEIYDKYHQNVLGTIYIDKQNSKKYGICQGNLVSKDV
YKVDLVVEKPEPENSPSNIAIGGRYVLLPEVFKYLDMKIKGKSGEIELTDSILKTMDESE
CYAKIIDGSRYDIGNKLGYLDAILDFGLEREDLKEEFLDLIETKVEKTSSNN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataagaaaagctattattccttgtgctggatttggtactagatttttacccttt
actaaatcacaagcaaaagaaatgctgcctataatagacaaacctgctatagaatttatt
gttaaagaggcaataaatagcggtattgaagaaattttaattataatacgcgctggaaaa
aatcatatagcaaaccattttaatagaaatattgaattagaatactttttagcagaaaaa
aataaaataagtgaattacaactaataagtgaaaaatataacgcaacaatttattatcta
attcaagaagaacaacttggtttaggacatgctatttctttagcaaaagattttataaaa
gatgaaccatttgctgtgcttttaggtgatgatttatttaaatgtaaaataccagctatt
aagcaattaatagaaatttatgataagtatcatcaaaatgttcttggtactatttatatt
gataagcaaaatagcaaaaaatatggaatttgtcaaggtaatttagtttcaaaagatgtt
tataaagttgatttagttgttgaaaagccagaaccagaaaattccccaagtaatattgca
attggtggaagatatgttttattacctgaagtatttaaatatttagatatgaaaataaaa
ggtaaaagtggtgaaattgaattaactgattcaattttaaaaacaatggatgaatctgag
tgttatgctaagataattgatggttcaagatatgatattggaaataaattaggttatctt
gatgctattttagattttggtttagaaagagaagatttaaaagaagagtttttagattta
atagaaaccaaagttgaaaaaacatcatcaaacaattag

DBGET integrated database retrieval system